[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAS80557.1 tthe0 AAS80557.1 "hypothetical conserved protein"
MRALLHLLLFLALLPSLLALAPRLRAQAPGPVALVLDAEAVREEARARGEDLMAALARYQ
AFGVNGVAFPERLVRDWVGEGVLLYRQGRELVEMGLSARPGWHYLKGDPALLALLERAYD
LPSERLGEWLGFPVDVQALPAFYNLEELRQAKAMGLYVMVRPLNHRLRRLEAGLPLVPKE
ADAVVFQGLEALGYPYRLGEAKALVPVPVALIEGTPQAGLGAFRDKGILRLFSLRYEWLL
TLKPEEAAEKYGLAARERSHQILYLRPYPYPEDTARLLKRLQEELKASGLPLGAPSPRAL
APSPLRYAAWVGVLAGLGLLALGLPVYGPLVAFLLLLFALGYAGSQAGPLLAALVFPVLG
FLGPRNGLWMWARSLGYALLGAVFLSALGSTEEAIAGLAPFKGVSLTLLVPPLLVAYSFL
EKDFKEALTRLFLHPARLGEVALGGLALGLLLLALLRRGNDAPIVPELELKLRALLQDVM
VRPRFKEVFGHALFPLALLLPWPRWVQNGLLFLASLGIASILNTFSHYHTPLPISFFRVL
NGALLGLSLGLVGVILVRRLRAWWSA
//