[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:AAS80636.1"

            "UDP-N-acetyl-D-mannosamine 6-dehydrogenase"
            ""

OrgPattern ---1-11-1111-21-11111212222313-2221222232232314333133-3422112---2-1- 255-521222311112211-11--2411111123231324133313321111333241--63321143432-1111----2-11212266631A33---32222143323--------------1-211112122122221---213113111-1111111111125112311112111121211-1-22-1232334423324232423122233353321543------552111111111111111-----------------------------1----111----3311111-12----------------------222-13111121112121222111212121----33412314--1-121--3222222-----314323221112411111111112-33243423321-3222222222231111121-12112211111111122211211------------11111111111111-2-1342212333332232221111335222221233512211121231121-1121--142-1231-------221443-323422222322233232232234535224222222---1---2-------22-4131312122221-121121-112211-211-21---2212------22312222222222232-22222222222222222222222343222222222223323222222111321222222222222--1122222----133131111111----1--21111112111524434335342322-323-111111112--222222221-2222222222222222--22111111---------------------------1--------1112211111111 --11--1-------14222-11-1222---------------------23663533-2-2221--------------------------11121-111111-1112-232211111111-111-21-1-131-111----1-11-1111-1-12-111211111121111611112221I21112543211-1231111 ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---

Master   AminoSeq   


1: . . . . + .: 60 :MTASETHLQALKEKITNRTAIVGVVGLGYVGLPFAVEKAKVGFRVIGVEQNPRRAELVNR:Sequence : HHHHHHHTcTcEEEEEcccHHHHHHHHT:Sec Str : XXXXXXXXXXX :SEG|22->32|vgvvglgyvgl : ============================:RP:SCP|33->197|1mfzA2|4e-32|30.9|165/202|c.2.1.6 : ============================:BL:SWS|33->426|EPSD1_RALSO|4e-55|37.4|377/423 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|33->197|PF03721|3e-22|41.2|165/186|UDPG_MGDP_dh_N 61: . . . * . .: 120 :GESYIADVPTEVLKEVVDKGLLRAETGFDRVAEMDVIVIAVPTPLTRNLTPDLQYVERVT:Sequence :TccccccHHHHHHHHHccccEEEEccHHHHHHHccEEEEcccccETTTTEEccHHHHHHH:Sec Str :============================================================:RP:SCP|33->197|1mfzA2|4e-32|30.9|165/202|c.2.1.6 :============================================================:BL:SWS|33->426|EPSD1_RALSO|4e-55|37.4|377/423 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|33->197|PF03721|3e-22|41.2|165/186|UDPG_MGDP_dh_N 121: . . + . . .: 180 :REIAPRLRPGQLISLESTTYPGTTEEVMLPILEQSGLKVEEDFFLVHSPERVDPGNKRYT:Sequence :HHHHHHHccccEEEEcccccTTHHHHHHHHHTcTTcEEEEEEccEEEccccccTTcTTHH:Sec Str :============================================================:RP:SCP|33->197|1mfzA2|4e-32|30.9|165/202|c.2.1.6 :============================================================:BL:SWS|33->426|EPSD1_RALSO|4e-55|37.4|377/423 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|33->197|PF03721|3e-22|41.2|165/186|UDPG_MGDP_dh_N 181: . * . . . .: 240 :TRNTTKVVGGVGPRSLEAGVFFYSQTIEKVVPVSSAKAAELVKVFENTFRAVNIALVNEL:Sequence :HHccccEEEEccTTccHHHHHHHcccccccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHH:Sec Str :================= :RP:SCP|33->197|1mfzA2|4e-32|30.9|165/202|c.2.1.6 : =========================:RP:SCP|216->313|1dliA1|1e-34|29.2|96/98|a.100.1.4 :============================================================:BL:SWS|33->426|EPSD1_RALSO|4e-55|37.4|377/423 :$$$$$$$$$$$$$$$$$ :RP:PFM|33->197|PF03721|3e-22|41.2|165/186|UDPG_MGDP_dh_N : $$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|216->309|PF00984|3e-20|48.9|94/96|UDPG_MGDP_dh 241: + . . . . *: 300 :AMLCDRMGLNVWEVLDAAFTKPFGIMPFYPGPGVGGHCIPIDPHYLEWKAKEYNFNTHFI:Sequence :HHHHHHTTccHHHHHHHHHTcTTccccccccccccccHHHHHHHHHHHHTTTccccHHHH:Sec Str :============================================================:RP:SCP|216->313|1dliA1|1e-34|29.2|96/98|a.100.1.4 :============================================================:BL:SWS|33->426|EPSD1_RALSO|4e-55|37.4|377/423 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|216->309|PF00984|3e-20|48.9|94/96|UDPG_MGDP_dh 301: . . . . + .: 360 :ALAGEINRKMPEFTVEKALRVLAEAGVPVRGAKVLVLGVAYKRDIPDYRESPAIEVIRGL:Sequence :HHHHHHHHHHHHHcGHHHHHHHHHHTccccccEEEEEcccccTTccccTTcHHHHHHHHH:Sec Str :============= :RP:SCP|216->313|1dliA1|1e-34|29.2|96/98|a.100.1.4 : ===========================================:RP:SCP|318->415|1dliA3|5e-14|17.5|97/108|c.26.3.1 :============================================================:BL:SWS|33->426|EPSD1_RALSO|4e-55|37.4|377/423 :$$$$$$$$$ :RP:PFM|216->309|PF00984|3e-20|48.9|94/96|UDPG_MGDP_dh : $$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|336->423|PF03720|8e-07|38.6|88/104|UDPG_MGDP_dh_C 361: . . . * . .: 420 :RRLGAEVEYHDPHVPRFAEGGLAMESVPLSEERVREKDLVLIATDHSAFDYKAIVAQARR:Sequence :HTcccEEEEEcTTcccccTcTcccEEcccHHHHHHHccEEEcccccGGGGGGGGGGGEEc:Sec Str :======================================================= :RP:SCP|318->415|1dliA3|5e-14|17.5|97/108|c.26.3.1 :============================================================:BL:SWS|33->426|EPSD1_RALSO|4e-55|37.4|377/423 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|336->423|PF03720|8e-07|38.6|88/104|UDPG_MGDP_dh_C 421: . . + . . .: 480 :VLDARGATRHLPRELTEGKVVLL :Sequence :ccccc :Sec Str :====== :BL:SWS|33->426|EPSD1_RALSO|4e-55|37.4|377/423 :$$$ :RP:PFM|336->423|PF03720|8e-07|38.6|88/104|UDPG_MGDP_dh_C