[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:AAS80650.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDRRLLALLSGVLLGTVSESSLAPALPVLERAFAVGPEAAQGVVSLGLLGAALAYLPLAG:Sequence : XXXXXXXXXXXXXXXXXX :SEG|5->22|llallsgvllgtvsessl : XXXXXXXXXXXXXXXXXXXXXX:SEG|39->72|aaqgvvslgllgaalaylplaglagrvgagrlfr 61: . . . * . .: 120 :LAGRVGAGRLFRTGLFLHALSALLLALAPSLLALYLLRLLQGVATAMVVGLVPGLAASAF:Sequence :XXXXXXXXXXXX :SEG|39->72|aaqgvvslgllgaalaylplaglagrvgagrlfr : XXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|75->100|lflhalsalllalapsllalyllrll 121: . . + . . .: 180 :PEARGYALGMVASTVAAGTLLGPALGGLAAGWGLPYVFLLPLPAALLALLLSGNLPELPR:Sequence : XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|136->179|aagtllgpalgglaagwglpyvfllplpaallalllsgnlpelp 181: . * . . . .: 240 :QEGTLPGLLRAPGFLPALLATGLYFLHALGTTVALAFHLGKEGFSPGAIGGLLLLGPLEL:Sequence : XXXXXXXXXXX:SEG|230->244|ggllllgplellflg 241: + . . . . *: 300 :LFLGAWAGRRADRMGYNRVALLGAYLLVAAGLAFALLPLLHPLWGSALALLLLGVGRALF:Sequence :XXXX :SEG|230->244|ggllllgplellflg : XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|260->299|allgayllvaaglafallpllhplwgsalallllgvgral 301: . . . . + .: 360 :QAANNALVLSLAPKGTEGLASGALSVARALGQALGSALAGGSLGLFYRLFPSHGLAFAAT:Sequence : XXXXXXXXXXXXXXXXXXX :SEG|327->345|aralgqalgsalaggslgl : XXXXXXX:SEG|354->386|glafaatallltalmglaaflvrgregsgeevg 361: . . . * . .: 420 :ALLLTALMGLAAFLVRGREGSGEEVGHAPLDDPGGEGGA :Sequence :XXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|354->386|glafaatallltalmglaaflvrgregsgeevg