[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:AAS80675.1"

            "glucose transport system permease protein"
            ""

OrgPattern 11--31---1--1---31111---3--2--2-----------------------1241--11-1---- ---1I2-2333-1112233-3-2247333334-33313443--2BZE-488-C9C113--44647258B8133337441---3-----------------------------------------------------33366---52221211-1111111222221-223--1-----1----A9-5634-532------11-------A83311--112613132122118O--------------------121-11---------11-----2--1-1-----21123323332223-------------121---222142-18-----112-342--12226------4--12---1A---65561-1-------11111--654---3122145544555558---2--1--3B--MFF8KHHUQLIH-----5842222953--------2--1--12-----------------------------1---1--11114554443-111225522211133311----1114----122432-------2---------------------1--11111-------------22---------------------------------------2---------------------------------244-2-1--1111111--1111-1111-1-11111-23222-------------------2---1111--133333333333---------11111-326---------------------------11111111111111111-------------------1-122--111111111111-------------------1--------------------------3C7657E586-1- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRDRILAFLVLLPSVLAVGVFVYGFIGQNLWVSLTDWGKDPAQALALRPELRFVGLENYR:Sequence : :Sec Str : ==========================================================:BL:SWS|3->138|UGPA_AGRT5|7e-08|25.4|126/293 61: . . . * . .: 120 :ELFTGFVDVRFRQSVVNLIFFTLFFMAGSLGLGLLLALAVDKAPRGEGFFRTVFLFPMAL:Sequence : :Sec Str : XXXXXXXXXXXXX :SEG|87->99|agslglglllala :============================================================:BL:SWS|3->138|UGPA_AGRT5|7e-08|25.4|126/293 121: . . + . . .: 180 :SFVVTGTIWRWLLQPQGGVNVLPTLFGLPPLSFPWLATREQVLVFDWNRLPFYTALVVGL:Sequence : :Sec Str : XXXXXXXX:SEG|173->190|ytalvvglvllyvaytay :================== :BL:SWS|3->138|UGPA_AGRT5|7e-08|25.4|126/293 181: . * . . . .: 240 :VLLYVAYTAYREGERRRALWGLASAGVLLLWAFAFGQGLRLLPYPEVHGFSLALVGVILA:Sequence : HHHHHHHHHc TTcTTTGGGTTTcHHHHHHTTTTHH:Sec Str :XXXXXXXXXX :SEG|173->190|ytalvvglvllyvaytay : =================================:RP:SCP|208->337|2r6gG1|9e-13|20.2|129/284|f.58.1.1 : =========:BL:SWS|232->368|Y1215_PYRHO|3e-22|51.1|137/292 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|207->314|PF00528|3e-08|38.5|104/195|BPD_transp_1 241: + . . . . *: 300 :AVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFRRVIFPMLAPITLSAMIVLGH:Sequence :HHHHHHHHHHHHHHHHHTTccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|208->337|2r6gG1|9e-13|20.2|129/284|f.58.1.1 :============================================================:BL:SWS|232->368|Y1215_PYRHO|3e-22|51.1|137/292 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|207->314|PF00528|3e-08|38.5|104/195|BPD_transp_1 301: . . . . + .: 360 :IALKIFDLVFAMAGLDYAPTDVPAIYMYLLAFRGNQFAKGAAIGILLLLLVAVVVVPYLA:Sequence :HHTTcHHHHHHHHH GGGGccG :Sec Str : XXXXXXXXXXXXXXXXX :SEG|340->356|gaaigilllllvavvvv :===================================== :RP:SCP|208->337|2r6gG1|9e-13|20.2|129/284|f.58.1.1 :============================================================:BL:SWS|232->368|Y1215_PYRHO|3e-22|51.1|137/292 :$$$$$$$$$$$$$$ :RP:PFM|207->314|PF00528|3e-08|38.5|104/195|BPD_transp_1 361: . . . * . .: 420 :TQLRKEVRR :Sequence : :Sec Str :======== :BL:SWS|232->368|Y1215_PYRHO|3e-22|51.1|137/292