[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:AAS80689.1"

            "putative hydrolase"
            ""

OrgPattern --------111111------------------------------------------------------ --1-1----------------1---1-------111-142-11-1---------------------1---1-----------1-------------------------------------------------------------11-----------------------1-------------11-1---------------------------------------------1-------------------------------------------------------------------------------------------2--------------------------1-----------1-------------11-------1111111----1--------------1--1-111--111-1----1--22-----21-11111------------------------------------------------3--11111-------------11--------12112---11-------1----------11-------------------------------112----------2----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-221211---11111111--------------------------11111111------------------------1---------------------------1---------- ------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------ -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MARLRYRLEGEGPPVVLLNGIFQRLESWDPVLPHLTGFTLLRYDMRGQGESEAPEGPYPP:Sequence :ccEEEEEEEcccEEEEEEccTTccGGGGTTHHHHHHTEEEEEEccTTcGGGTTcccHccH:Sec Str : ==========================================================:RP:SCP|3->112|1a7uA|5e-16|28.2|110/277|c.69.1.12 : =========================================================:BL:SWS|4->114|YTXM_BACSU|2e-09|36.9|111/274 61: . . . * . .: 120 :RAHAEDLLALLDEAKLSRPALVGLSNGGIVAMEAALLAPERFSALVLCCTTPYLDAALRA:Sequence :HHHHHHHHHHHHHTTcccEEEEEETHHHHHHHHHHHHcGGGEEEEEEEcccccccHHHHH:Sec Str : XXXXXXXXXXXXX :SEG|62->74|ahaedllalldea :==================================================== :RP:SCP|3->112|1a7uA|5e-16|28.2|110/277|c.69.1.12 :====================================================== :BL:SWS|4->114|YTXM_BACSU|2e-09|36.9|111/274 121: . . + . . .: 180 :KVESWLHALKTGGTVLRLRVALPWVFGRGFLEAHPELLAEEGLRGLAAQAPTKTAQERLL:Sequence :HHHHHHHHHHTTcccHHHHHHHHHHccHHHHTcHHHHHHHHHHHHHHHccccccHHHHHH:Sec Str : XXXXXXXXXXXXXXX :SEG|156->170|ellaeeglrglaaqa 181: . * . . . .: 240 :LGFLTLEDLRPRLKALALPALVLYGTEDLLFPKAYASNLAEALRARLEALPAGHAAPIEA:Sequence :TTcccccccGGGGGGccccEEEEEETTcccccHHHHHHHHcTTEEEEEETTccTTHHHHc:Sec Str : XXXXXXXXXXXXXXX :SEG|189->203|lrprlkalalpalvl : XXXXXXXXXXXX :SEG|219->230|laealrarleal 241: + . . . . *: 300 :PLAFARAVRAFLEEVYA :Sequence :HHHHHHHHHHHHHHccc :Sec Str