[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:AAS80708.1"

            "histidyl-tRNA synthetase"
SYH_THET8   "RecName: Full=Histidyl-tRNA synthetase;         EC=6.1.1.21;AltName: Full=Histidine--tRNA ligase;         Short=HisRS;"

OrgPattern 11111111111111111111111111111111111111111111111111111111111111111111 1111111111111111111-111111111111111111111111111111--11111111-1-111111111111---1112211211111111111--1111111111111111111111111111111111111222222222222222222211111111112122221221111111111111111112233333333133333332221233322222111111113311111111111111111111111111111112222111111211111111111111111111111111111111111111111111111113123222221212221222111312112222112221222122221111111111111111111111111111111111111111-1111121111111111111111111111111111112121111111111111-1111111111111111111111111111111-1111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111112221221121111111111-1111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 111122--31--1111-1--111111111-1111111111111111111111112211-111111111111-111111111-111111-121-11----1111222-2222211-1-1111-1---1---1----111-112111-111111-11112213--1-1-121--2111-2-N1111112422122233222 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTARAVRGTKDLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAATDI:Sequence :GcccccTTcccccHHHHHHHHHHHHHHHHHHHHTTcEEcccccEEEHHHHHHHHcTTcHH:Sec Str : ===========================================================:RP:SCP|2->325|1adjA2|9e-62|99.7|324/324|d.104.1.1 :============================================================:BL:SWS|1->421|SYH_THET8|0.0|100.0|421/421 : $$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|38->168|PF00587|3e-10|38.0|129/170|tRNA-synt_2b 61: . . . * . .: 120 :VRKEMFTFQDRGGRSLTLRPEGTAAMVRAYLEHGMKVWPQPVRLWMAGPMFRAERPQKGR:Sequence :HHHcccEEEcTTccEEEEccccHHHHHHHHHHTTGGGccccEEEEEEEEEEccccccccc:Sec Str :============================================================:RP:SCP|2->325|1adjA2|9e-62|99.7|324/324|d.104.1.1 :============================================================:BL:SWS|1->421|SYH_THET8|0.0|100.0|421/421 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|38->168|PF00587|3e-10|38.0|129/170|tRNA-synt_2b 121: . . + . . .: 180 :YRQFHQVNYEALGSENPILDAEAVVLLYECLKELGLRRLKVKLSSVGDPEDRARYNAYLR:Sequence :ccEEEEEEEEEEccccHHHHHHHHHHHHHHHHHTTccccEEEEEEcccHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|2->325|1adjA2|9e-62|99.7|324/324|d.104.1.1 :============================================================:BL:SWS|1->421|SYH_THET8|0.0|100.0|421/421 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|38->168|PF00587|3e-10|38.0|129/170|tRNA-synt_2b 181: . * . . . .: 240 :EVLSPHREALSEDSKERLELNPMRILDSKSERDQALLKELGVRPMLDFLGEEARAHLKEV:Sequence :HHHGGGGGGccHHHHHHTTccGGGGTTcccHHHHHHHHHHTcccGGGGccHHHHHHHHHH:Sec Str :============================================================:RP:SCP|2->325|1adjA2|9e-62|99.7|324/324|d.104.1.1 :============================================================:BL:SWS|1->421|SYH_THET8|0.0|100.0|421/421 241: + . . . . *: 300 :ERHLERLSVPYELEPALVRGLDYYVRTAFEVHHEEIGAQSALGGGGRYDGLSELLGGPRV:Sequence :HHHHHHTTccEEEcccccccccccccEEEEEEccccccccEEEEEEEcTTHHHHTTcccc:Sec Str :============================================================:RP:SCP|2->325|1adjA2|9e-62|99.7|324/324|d.104.1.1 :============================================================:BL:SWS|1->421|SYH_THET8|0.0|100.0|421/421 301: . . . . + .: 360 :PGVGFAFGVERVALALEAEGFGLPEEKGPDLYLIPLTEEAVAEAFYLAEALRPRLRAEYA:Sequence :cEEEEEEEHHHHHHHHHHTTccccccccccEEEEEccHHHHHHHHHHHHHHTTTccEEEc:Sec Str :========================= :RP:SCP|2->325|1adjA2|9e-62|99.7|324/324|d.104.1.1 : ===================================:RP:SCP|326->421|1adjA1|2e-15|100.0|96/96|c.51.1.1 :============================================================:BL:SWS|1->421|SYH_THET8|0.0|100.0|421/421 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|333->416|PF03129|4e-05|36.9|84/91|HGTP_anticodon 361: . . . * . .: 420 :LAPRKPAKGLEEALKRGAAFAGFLGEDELRAGEVTLKRLATGEQVRLSREEVPGYLLQAL:Sequence :cccccHHHHHHHHHHTTccEEEEEcHHHHHHTEEEEEETTTccEEEEETTHHHHHHHHHH:Sec Str :============================================================:RP:SCP|326->421|1adjA1|2e-15|100.0|96/96|c.51.1.1 :============================================================:BL:SWS|1->421|SYH_THET8|0.0|100.0|421/421 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|333->416|PF03129|4e-05|36.9|84/91|HGTP_anticodon 421: . . + . . .: 480 :G :Sequence :c :Sec Str := :RP:SCP|326->421|1adjA1|2e-15|100.0|96/96|c.51.1.1 := :BL:SWS|1->421|SYH_THET8|0.0|100.0|421/421