[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:AAS80786.1"

            "hypothetical cytosolic protein"
            ""

OrgPattern -----------------------1------------------------11111-1111111------1 111-111111111111111-11111111111111111111111111-111111111-1--111-1111111----11111111----------------------11-1---------------111111111-1111111---11-------1------------1----------------111111111111111111111111111111111111111111111111111111111-111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11-1-111111111-111121111-----311113111111111111111112------1--441-1114111111111211131111111211111111111111111-----------------------------11111-111111111111111111111111111111111111111111111111111111111111-111111111111-1-----------111111111111111---------------------------1111-111-111-1111111111111111111--11111--------------------------------------------------------------------------------------------11111111111111----------------11111111111111111111111111111------------------------11111111111111---1111111--------11-------1111111111111111111-1---1-1-1-1- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MEEAPSLKTLLLAVLFAAGRPVALKELRALGHPEEAVLRALKALERDLEAGHLGVALERV:Sequence : cHHHHHHHHHHHHHHccccccHHHHHHHTcHHHHHHHHHHHHHHHHHHHTccEEEEEE:Sec Str : #######:PROS|54->67|PS00213|LIPOCALIN|PDOC00187| : ===========================================================:RP:SCP|2->80|1t6sA1|5e-10|29.1|79/85|a.4.5.60 : =======================================================:BL:SWS|6->168|SCPB_MOOTA|2e-36|47.9|163/195 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|9->166|PF04079|2e-33|53.2|158/160|DUF387 61: . . . * . .: 120 :AGGWRLVVHPKALEAVERVLKPSPPRLSRAALEVLALVAYHQPVTRAELEAMRGKGVEGV:Sequence :TTEEEEEEcGGGHHHHHHHHccHHHHHHHHHHHHHHHHHHHccEEHHHHHHHHTcccccH:Sec Str :####### :PROS|54->67|PS00213|LIPOCALIN|PDOC00187| :==================== :RP:SCP|2->80|1t6sA1|5e-10|29.1|79/85|a.4.5.60 : ==================================:RP:SCP|87->157|1t6sA2|9e-09|53.5|71/77|a.4.5.60 :============================================================:BL:SWS|6->168|SCPB_MOOTA|2e-36|47.9|163/195 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|9->166|PF04079|2e-33|53.2|158/160|DUF387 121: . . + . . .: 180 :LESLLERGLVRVVGEKEAPGRPKLYGTTERFLEVFGLESLEDLPPLREDGPPLLLRG :Sequence :HHHHHHTTcEEEEEEcccTTccEEEEEcHHHHHHTTc :Sec Str :===================================== :RP:SCP|87->157|1t6sA2|9e-09|53.5|71/77|a.4.5.60 :================================================ :BL:SWS|6->168|SCPB_MOOTA|2e-36|47.9|163/195 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|9->166|PF04079|2e-33|53.2|158/160|DUF387