[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAS80786.1 tthe0 AAS80786.1 "hypothetical cytosolic protein"
MEEAPSLKTLLLAVLFAAGRPVALKELRALGHPEEAVLRALKALERDLEAGHLGVALERV
AGGWRLVVHPKALEAVERVLKPSPPRLSRAALEVLALVAYHQPVTRAELEAMRGKGVEGV
LESLLERGLVRVVGEKEAPGRPKLYGTTERFLEVFGLESLEDLPPLREDGPPLLLRG
//