[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:AAS80787.1"

            "sua5 protein"
            ""

OrgPattern 111111111111111111111111111111111-1-11-1---1111111111111111111111-11 2221111111111111111-1111111111111111121111111121211111111111221112111121111111111111-11-111112111--221221112121111111111111111111111111111111111111222222211111111122221111-111111--11111-1111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111211111-11111111-11111111111111111111-11-11111111111111121111111111111111111111111111111111111111111111111111111111-111111111111111112222221222222112222222212222-12221212222222-22111123-111111111122112222111111--1111111111111112212-------------------------33111111111113111111211111111111---1211------211112-2222222222-2222222222222222222222111112112222222222222122222221-1111111111111-1-22212111112211111222-2222-221------1---2111112122222221111----------1111222221122211111111111111--2-112222131111111-11111------------------1-11111111111111 --11111-1111111211111111111--1111111-1-11-11-111111111--------11--------111------1111111-1-111-111111211111121731222-------------------------------1-----111113122-221111111111111-11121-11121-22121112 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MERVYQEALAKAAETLKGGGLVAFPTDTVWGVLALMEDEAACKRIYEVKGRPEDKPLQVL:Sequence :TTTcccEEEEEEEEEEcccEEEEccccccccGGGTTTcTTTcccTTcHHHHHHHHHHHTc:Sec Str : =======================================================:RP:SCP|6->181|1hruA|3e-41|33.5|176/186|d.115.1.1 : ====================================================:BL:SWS|9->192|YWLC_BACSU|4e-25|41.8|182/346 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|14->183|PF01300|8e-22|45.8|168/178|Sua5_yciO_yrdC 61: . . . * . .: 120 :VADLESALELVDLGPLEGKFLRLAEAFWPGGLTVVVPGKAIPPWISKDGSVGLRMPDHAL:Sequence :HHHHTTcccccTTcccTTHHHHHHHTHHHHHHHHHHHHHTTccHHHTccEEEEEEccHHH:Sec Str :============================================================:RP:SCP|6->181|1hruA|3e-41|33.5|176/186|d.115.1.1 :============================================================:BL:SWS|9->192|YWLC_BACSU|4e-25|41.8|182/346 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|14->183|PF01300|8e-22|45.8|168/178|Sua5_yciO_yrdC 121: . . + . . .: 180 :LRELLRRVGGHAAATSLNKSGEPPVRTEAEARTFAVDFVFPGEAGGLASSVVDLRTGEVL:Sequence :HHHHTTccEEEEcEEcccccccccEEEEEcccccTTcccEEEEccHHHHHHHHHHHcccE:Sec Str :============================================================:RP:SCP|6->181|1hruA|3e-41|33.5|176/186|d.115.1.1 :============================================================:BL:SWS|9->192|YWLC_BACSU|4e-25|41.8|182/346 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|14->183|PF01300|8e-22|45.8|168/178|Sua5_yciO_yrdC 181: . * . . . .: 240 :REGAIPKEALLAHLR :Sequence :EEEEEEEccccGG :Sec Str := :RP:SCP|6->181|1hruA|3e-41|33.5|176/186|d.115.1.1 :============ :BL:SWS|9->192|YWLC_BACSU|4e-25|41.8|182/346 :$$$ :RP:PFM|14->183|PF01300|8e-22|45.8|168/178|Sua5_yciO_yrdC