[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAS80787.1 tthe0 AAS80787.1 "sua5 protein"
MERVYQEALAKAAETLKGGGLVAFPTDTVWGVLALMEDEAACKRIYEVKGRPEDKPLQVL
VADLESALELVDLGPLEGKFLRLAEAFWPGGLTVVVPGKAIPPWISKDGSVGLRMPDHAL
LRELLRRVGGHAAATSLNKSGEPPVRTEAEARTFAVDFVFPGEAGGLASSVVDLRTGEVL
REGAIPKEALLAHLR
//