[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:AAS80853.1"

            "phosphatidate cytidylyltransferase"
            ""

OrgPattern -------------------------------------------------------------------- --1-111-11111-1--11-1---1-111111-----11111-1--1-1---11-2----1111-1-11111------1111--11--1111-1111--111--111--1--11-1----------11-11--11-111111111-111111211111111111-1111111111111111-1111111111111111111111111111111111111-1-1-11111111-11111111111111111111111-11-11-1111111111-111111111111111-----------11111111111111111111111-11-1---1111-1111--1-----11-11-1111111-111-111-11-1-1-11-----1-1-1----1--------------1-------1----11---11-111-1-----1111111------------11-----1111------11--11--1-------1-1-----1-----1111111--------------11-1-1-11--1-1-------1---1-111-11111111-1-12--1111-1-1--1111---2-1-111111111-2-1-1111111--11-11---11111111111-1111111---11----1--11111--12---------111111111111---11-11112111221-1111111111112211---------------111111111-1111111111111111111111111----11111111111111111-11111--11-22221212211111211111111111111112222211111111111111111111-1-11--111-1-11-1----------1------------------111111111-1- ------------------------------------------------------------------------------------------------------------21-----------------------------------------------------------------21---11111-----31115368- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTDHLPTRVFSALAGALLLLLVLWGGIPLILPTLLFVHWLGTRELAEMLARRGIALNTPL:Sequence : XXXXXXXXXXXXXXXXXXXXX :SEG|12->32|alagalllllvlwggiplilp : X:SEG|60->73|lllaggvlvflfsl 61: . . . * . .: 120 :LLAGGVLVFLFSLPQLYWHFPQVPWREVALGLFLLASFSYELLFGANLPRFAFGLMAFLY:Sequence :XXXXXXXXXXXXX :SEG|60->73|lllaggvlvflfsl : ========:BL:SWS|113->274|CDSA_BACSU|9e-26|45.6|158/269 : $$$$$$:RP:PFM|115->272|PF01148|1e-17|41.6|154/262|CTP_transf_1 121: . . + . . .: 180 :LPWSLGYVLLLRETPDAAMGLWTLTLPLVASFATDIGAYFIGRAFGRRKLAPEISPGKTV:Sequence :============================================================:BL:SWS|113->274|CDSA_BACSU|9e-26|45.6|158/269 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|115->272|PF01148|1e-17|41.6|154/262|CTP_transf_1 181: . * . . . .: 240 :EGSLGGIAVSFLALVVYTGLVREVFPFGLLELWLFSLLLSLGAQLGDLAESMLKRFAGVK:Sequence : XXXXXXXXXXXXXXXXXXXXX :SEG|208->228|gllelwlfslllslgaqlgdl : ##########:PROS|231->257|PS01315|CDS|PDOC01019| :============================================================:BL:SWS|113->274|CDSA_BACSU|9e-26|45.6|158/269 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|115->272|PF01148|1e-17|41.6|154/262|CTP_transf_1 241: + . . . . *: 300 :DSGNFLPGHGGLLDRIDSLLFAFPLTYFLVVLFT :Sequence :################# :PROS|231->257|PS01315|CDS|PDOC01019| :================================== :BL:SWS|113->274|CDSA_BACSU|9e-26|45.6|158/269 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|115->272|PF01148|1e-17|41.6|154/262|CTP_transf_1