[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:AAS80854.1"

            "ribosome recycling factor (rrf)"
RRF_THET8   "RecName: Full=Ribosome-recycling factor;         Short=RRF;AltName: Full=Ribosome-releasing factor;"

OrgPattern -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 ----111-----111-------------------------------------------------------------------------------------111111-141111--111-1-11111-1-431-121-1111-111-1---1--1-11-1----1-1-111---1-22229222212222-214221111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTLKELYAETRSHMQKSLEVLEHNLAGLRTGRANPALLLHLKVEYYGAHVPLNQIATVTA:Sequence :ccHHHHHHHHHHHHHHHHHHHHHHHHTccccccccGGGTccEEEETTEEEEGGGTcEEEc:Sec Str : ==========================================================:RP:SCP|3->184|1dd5A|2e-61|42.9|182/184|d.67.3.1 :============================================================:BL:SWS|1->185|RRF_THET8|2e-93|100.0|185/185 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|21->184|PF01765|5e-38|52.4|164/165|RRF 61: . . . * . .: 120 :PDPRTLVVQSWDQNALKAIEKAIRDSDLGLNPSNKGDALYINIPPLTEERRKDLVRAVRQ:Sequence :ccTTEEEEEcccHHHHHHHHHHHcccTTcccEEEETTEEEEEcccccTTHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|3->184|1dd5A|2e-61|42.9|182/184|d.67.3.1 :============================================================:BL:SWS|1->185|RRF_THET8|2e-93|100.0|185/185 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|21->184|PF01765|5e-38|52.4|164/165|RRF 121: . . + . . .: 180 :YAEEGRVAIRNIRREALDKLKKLAKELHLSEDETKRAEAEIQKITDEFIAKADQLAEKKE:Sequence :HHHHHHHHHHHHHHHHHHHHHHHHHHHTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH:Sec Str : XXXXXXXXXXXXX :SEG|135->147|ealdklkklakel :============================================================:RP:SCP|3->184|1dd5A|2e-61|42.9|182/184|d.67.3.1 :============================================================:BL:SWS|1->185|RRF_THET8|2e-93|100.0|185/185 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|21->184|PF01765|5e-38|52.4|164/165|RRF 181: . * . . . .: 240 :QEILG :Sequence :HHHTc :Sec Str :==== :RP:SCP|3->184|1dd5A|2e-61|42.9|182/184|d.67.3.1 :===== :BL:SWS|1->185|RRF_THET8|2e-93|100.0|185/185 :$$$$ :RP:PFM|21->184|PF01765|5e-38|52.4|164/165|RRF