[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:AAS80903.1"

            "hypothetical conserved protein"
Y924_THET8  "RecName: Full=UPF0103 protein TTHA0924;"

OrgPattern -------------------------------------------------------------------- -----------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MEGRLRLREPQITPIEGGFLVSDPYGVYEKPLALTEGGLFLLSLMEGRTLEEVQEEVFKR:Sequence : :Sec Str : ================:BL:SWS|45->370|Y924_THET8|e-134|100.0|326/326 61: . . . * . .: 120 :HGVLVPKKELEDLAKALEEAGLLLTEKVEARLKEEEEKLKRERPMRLAGLSYPEGEREAR:Sequence : cTTTccccHHHHH:Sec Str : XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|67->107|kkeledlakaleeagllltekvearlkeeeeklkrerpmrl : XXXXXXX:SEG|114->128|egerearafleafra :============================================================:BL:SWS|45->370|Y924_THET8|e-134|100.0|326/326 121: . . + . . .: 180 :AFLEAFRASYPGEGEEARVLLMPHLEPSRVPEVYGAALAALEKTPPPERIYLVGVAHRPL:Sequence :HHHHHHHHTcccccccccEEEEccccHHHHHHHHHHHHTTccTTTTccEEEEEEEccccc:Sec Str :XXXXXXXX :SEG|114->128|egerearafleafra :============================================================:BL:SWS|45->370|Y924_THET8|e-134|100.0|326/326 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|131->343|PF01875|1e-12|29.5|210/276|Memo 181: . * . . . .: 240 :KEKAAALPVPFQTPFGPALPDLPALQALDALLPFELFNTPLAFREEHSLELPLFFLKGRF:Sequence :cccEEEcccEEccccccEEccHHHHHHHHHTTcEEEccHHHHHHHccTTGGGHHHHHHHH:Sec Str : XXXXXXXXXXXXXXXXX :SEG|197->213|palpdlpalqaldallp :============================================================:BL:SWS|45->370|Y924_THET8|e-134|100.0|326/326 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|131->343|PF01875|1e-12|29.5|210/276|Memo 241: + . . . . *: 300 :PEARVLPLLVARRSPELGEALKVVLRDFPGLLVLAVDLSHVGPRFGDTPLTRTLAEEARR:Sequence :GccEEEEEEEccccHHHHHHHHHHHTcTTEEEEEEccccEEcGGGTcccccGGGccHHHH:Sec Str :============================================================:BL:SWS|45->370|Y924_THET8|e-134|100.0|326/326 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|131->343|PF01875|1e-12|29.5|210/276|Memo 301: . . . . + .: 360 :RDLGFLERLAEGEPEAALAFLGANPTRIDGVEVVASLLPLLRERKGKVLAHRLDLEAPTL:Sequence :HHHHHHHHHHTTcHHHHHHHHHHHccccTTHHHHHHHHHHHHHHHTTTccEEEEEEEEEE:Sec Str :============================================================:BL:SWS|45->370|Y924_THET8|e-134|100.0|326/326 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|131->343|PF01875|1e-12|29.5|210/276|Memo 361: . . . * . .: 420 :SAVGAGTLVL :Sequence :cTEEEEEEEE :Sec Str :========== :BL:SWS|45->370|Y924_THET8|e-134|100.0|326/326