[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:AAS80912.1"

            "glutamate-1-semialdehyde 2,1-aminomutase"
GSA_THET2   "RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase;         Short=GSA;         EC=5.4.3.8;AltName: Full=Glutamate-1-semialdehyde aminotransferase;         Short=GSA-AT;"

OrgPattern 44121234555555541433233321122223222222222222222221332254523222226-34 4753622222233252233-362239323333755555A8554525222224545333116471849A9961---121-1115322221212-211-1-3454555362611111112122222113211111131788871115743322242222122311322375822222111222213444411-73577777677687766767556478A65545423333338735544443445554444445-------1---2222-----231111-------111------------------------2--111----23245-------1-142332111213--51133223344333333222123213444--1-1547572515544344554553555--15--3-2392-76675576657A132212454344246222222223212222-222-----12---------------1-11113432688858AA89967776779B88884885644542254546422445465431322263222222244435414442121133221222222243322225344212112222211111111112112322433242523346333363433334334363--144421-----65442446665655565-66666556666566666646764666255554555455555556553445521334444344444--12222223234346562223231111122234443334232456666666B5787728E921111111122222222223422222323233321222222-443322------------------------------------1221212111322 1---231-1---111154242325562441122121233223332233335255124-2322212-1111111-21--1-12121123-2-251124233212332-2334243212111-2218522-292-22212124212221-1131-32323324825111234833313431S2125553354532321322 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MEGMERPISEAYFQEAKRHIPGGVSSPVRAFKAVGGTPPFLVRGEGAYVWDADGNRYLDY:Sequence :ccccccHHHHHHHHHHHHHcGGGcccGGGGcTTTccccccEEEEEcTEEEETTccEEEEc:Sec Str : ====================================================:RP:SCP|9->427|1sf2A|9e-57|24.8|399/425|c.67.1.4 :============================================================:BL:SWS|1->427|GSA_THET2|0.0|100.0|427/427 : $$$$$$$$$$$$$$$$$$:RP:PFM|43->347|PF00202|1e-35|42.0|295/336|Aminotran_3 61: . . . * . .: 120 :VMSWGPLILGHAHPKVLARVRETLERGLTFGAPSPLEVALAKKVKRAYPFVDLVRFVNSG:Sequence :cGGGTTcTTccTcHHHHHHHHHHHHTccccccccHHHHHHHHHHHHHcTTccEEEEEccH:Sec Str :============================================================:RP:SCP|9->427|1sf2A|9e-57|24.8|399/425|c.67.1.4 :============================================================:BL:SWS|1->427|GSA_THET2|0.0|100.0|427/427 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|43->347|PF00202|1e-35|42.0|295/336|Aminotran_3 121: . . + . . .: 180 :TEATMSALRLARGYTNRPYIVKFRGNYHGHADGLLVEAGSGALTLGVPSSAGVPEEYAKL:Sequence :HHHHHHHHHHHHHHHcccEEEEETTccccccGGGcEEcccccccccEEccTTccHHHHTT:Sec Str :============================================================:RP:SCP|9->427|1sf2A|9e-57|24.8|399/425|c.67.1.4 :============================================================:BL:SWS|1->427|GSA_THET2|0.0|100.0|427/427 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|43->347|PF00202|1e-35|42.0|295/336|Aminotran_3 181: . * . . . .: 240 :TLVLEYNDPEGLREVLRRRGEEIAAIIFEPVVGNAGVLVPTEDFLKALHEAREFGVLLIA:Sequence :EEEEcTTcHHHHHHHHHHHGGGEEEEEEcccccTTccccccHHHHHHHHHGGGGTcEEEE:Sec Str : XXXXXXXXXXXXX :SEG|190->202|eglrevlrrrgee : ###:PROS|238->274|PS00600|AA_TRANSFER_CLASS_3|PDOC00519| :============================================================:RP:SCP|9->427|1sf2A|9e-57|24.8|399/425|c.67.1.4 :============================================================:BL:SWS|1->427|GSA_THET2|0.0|100.0|427/427 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|43->347|PF00202|1e-35|42.0|295/336|Aminotran_3 241: + . . . . *: 300 :DEVMTGFRLAFGGATELLGLKPDLVTLGKVLGGGLPAAAYAGRREIMEKVAPLGPVYQAG:Sequence :EcTTTTTTccTTHHHHHHTccccEEEEcGGGGTTcccEEEEEcHHHHTTcTTTccccccc:Sec Str : XXXXXXXXXXXXXXXXXXX :SEG|264->282|lvtlgkvlggglpaaayag :################################## :PROS|238->274|PS00600|AA_TRANSFER_CLASS_3|PDOC00519| :============================================================:RP:SCP|9->427|1sf2A|9e-57|24.8|399/425|c.67.1.4 :============================================================:BL:SWS|1->427|GSA_THET2|0.0|100.0|427/427 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|43->347|PF00202|1e-35|42.0|295/336|Aminotran_3 301: . . . . + .: 360 :TLSGNPLAMAAGLATLELLEENPGYYRYLEDLGARLERGLKEVLAQKGIPHAVNRVGSMV:Sequence :TTcccHHHHHHHHHHHHHHHHcTHHHHHHHHHHHHHHHHHHHHHHHTTcccEEEEETTEE:Sec Str : XXXXXXXXXXXXXXX :SEG|307->321|lamaaglatlellee :============================================================:RP:SCP|9->427|1sf2A|9e-57|24.8|399/425|c.67.1.4 :============================================================:BL:SWS|1->427|GSA_THET2|0.0|100.0|427/427 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|43->347|PF00202|1e-35|42.0|295/336|Aminotran_3 361: . . . * . .: 420 :TVFFTEGPVVTFQDAKRTDTELFKRFFHGLLDRGIYWPPSNFEAAFLSVAHTEEDVEKTL:Sequence :EEEccccccccHHHHTTccHHHHHHHHHHHHTTTEEccccccccEEccTTccHHHHHHHH:Sec Str :============================================================:RP:SCP|9->427|1sf2A|9e-57|24.8|399/425|c.67.1.4 :============================================================:BL:SWS|1->427|GSA_THET2|0.0|100.0|427/427 421: . . + . . .: 480 :EALGEAL :Sequence :HHHHHHc :Sec Str :======= :RP:SCP|9->427|1sf2A|9e-57|24.8|399/425|c.67.1.4 :======= :BL:SWS|1->427|GSA_THET2|0.0|100.0|427/427