[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:AAS81022.1"

            "signal recognition particle protein ffh"
            ""

OrgPattern 22222222111222222222222222222222222222222222222222222222222222222-22 2222222222221222222-22222222222222222222222222122222222222222222222222222222222222223222222222222--222222222222222222222222222222222222222222---2222222222222222222222222222222222222222222222-32232323232323333222222232222222222222222322222222222222132222221222222222222222222222122222222222222222222222222222222222222222222232222222222222232222222323223223333322322223333222222222222222222222222222222222222222-22222222222222222222222222222222222222222222222222222222222222222222222222222222222222222223223333333333333333333333323232222333222222222322222243222222222222222222223222222222222232332222222232222222222222222222222222223322222222233333222333333223222-2222322222222222222222222222-2222222222222222222222222222222222222222222222222122222222222222222222222222222222222222222222222222212222222222223333333333333222222222322222222233232222222233422222222------2222222222222222-22222222222222222222222232323222 2222223-622222221222222222222211122122112221113211222211111222211111111-1111111111111111-22212222122222222221533412221122221331312B2-2211121111121222111132233224522222223712324444s44444569C1664432224 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MFQQLAARLQEAIDRLRGRGRITEEDLKGTLREIRRALIEADVNLEVARAFVEEVRERAL:Sequence :ccTHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHH:Sec Str : XXXXXXXXXXXXXX :SEG|46->59|evarafveevrera : ===========================================================:RP:SCP|2->88|1ffhA1|4e-12|74.7|87/87|a.24.13.1 :============================================================:BL:SWS|1->434|SRP54_THEAQ|0.0|82.1|430/430 61: . . . * . .: 120 :GRKVLESLTPAEVVLATVYEALKEALGGEPKHPQLKDRNVWFLVGLQGSGKTTTAAKLAL:Sequence :HccccTTccHHHHHHHHHHHHHHTccHHHTTcccccccEEEEEEccTTccHHHHHHHHHH:Sec Str :============================ :RP:SCP|2->88|1ffhA1|4e-12|74.7|87/87|a.24.13.1 : ================================:RP:SCP|89->295|1ffhA2|6e-15|80.5|200/200|c.37.1.10 :============================================================:BL:SWS|1->434|SRP54_THEAQ|0.0|82.1|430/430 : $$$$$$$$$$$$$$$$$$$$$:RP:PFM|100->292|PF00448|1e-45|54.4|193/196|SRP54 121: . . + . . .: 180 :YYKGKGRRPLLVAADTQRPAAREQLRVLGEKVGVPVLEVQDGESPESIRRRVEERARLEV:Sequence :HHHTTTccEEEEEcccccTHHHHHHHHHHGGGTcEEEccTTcccHHHHHHHHHHHHHHTT:Sec Str : XXXXXXXXXXXX:SEG|169->187|rrrveerarlevrdlvlvd :============================================================:RP:SCP|89->295|1ffhA2|6e-15|80.5|200/200|c.37.1.10 :============================================================:BL:SWS|1->434|SRP54_THEAQ|0.0|82.1|430/430 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|100->292|PF00448|1e-45|54.4|193/196|SRP54 181: . * . . . .: 240 :RDLVLVDTAGRLQIDERLMEELVRLKAALRPDEVLLVLDAMTGQEALSVAQAFDERVGVT:Sequence :ccEEEEEccccccccHHHHHHHHHHHHHHcccEEEEEEEGGGGGGHHHHHHHHHHccTTE:Sec Str :XXXXXXX :SEG|169->187|rrrveerarlevrdlvlvd :============================================================:RP:SCP|89->295|1ffhA2|6e-15|80.5|200/200|c.37.1.10 :============================================================:BL:SWS|1->434|SRP54_THEAQ|0.0|82.1|430/430 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|100->292|PF00448|1e-45|54.4|193/196|SRP54 241: + . . . . *: 300 :GLVLTKLDGDARGGAALSARRVTGKPIYFAGVSERPEGLEPFYPDRLAGRILGMGDVATL:Sequence :EEEEEcccccccHHHHHHHHHTTcccEEEEEccccTTcEEEccHHHHHHHHTTTTcHHHH:Sec Str : ############## :PROS|266->279|PS00300|SRP54|PDOC00272| :======================================================= :RP:SCP|89->295|1ffhA2|6e-15|80.5|200/200|c.37.1.10 : ======:RP:SCP|295->420|1qzwA2|1e-36|34.1|126/138|a.36.1.1 :============================================================:BL:SWS|1->434|SRP54_THEAQ|0.0|82.1|430/430 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|100->292|PF00448|1e-45|54.4|193/196|SRP54 301: . . . . + .: 360 :AEKVRQAGLEAEAPKSAKELTLEDFLKQMQNLKRLGSFSELLKLLPGVGRALPQGFQVDE:Sequence :HHHHHHHHTTHHHHHHTTcccHHHHHHHHHHHHTTccccEEEccccccccGGGccccccH:Sec Str :============================================================:RP:SCP|295->420|1qzwA2|1e-36|34.1|126/138|a.36.1.1 :============================================================:BL:SWS|1->434|SRP54_THEAQ|0.0|82.1|430/430 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|322->417|PF02978|7e-23|54.2|96/101|SRP_SPB 361: . . . * . .: 420 :RAFKRLEAIVLSMTPEERKDPRILNASRRRRIAKGSGTTVQEVNRLVKAFEETKALMKSL:Sequence :HHHHHHHHHHTTccHHHHHcGGGccHHHHHHHHHHHTccHHHHHHHHHHHHHHHHHHHTc:Sec Str :============================================================:RP:SCP|295->420|1qzwA2|1e-36|34.1|126/138|a.36.1.1 :============================================================:BL:SWS|1->434|SRP54_THEAQ|0.0|82.1|430/430 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|322->417|PF02978|7e-23|54.2|96/101|SRP_SPB 421: . . + . . .: 480 :ERRKGRGLMGMFRR :Sequence :cccccccTTHHHH :Sec Str :============== :BL:SWS|1->434|SRP54_THEAQ|0.0|82.1|430/430