[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAS81022.1 tthe0 AAS81022.1 "signal recognition particle protein ffh"
MFQQLAARLQEAIDRLRGRGRITEEDLKGTLREIRRALIEADVNLEVARAFVEEVRERAL
GRKVLESLTPAEVVLATVYEALKEALGGEPKHPQLKDRNVWFLVGLQGSGKTTTAAKLAL
YYKGKGRRPLLVAADTQRPAAREQLRVLGEKVGVPVLEVQDGESPESIRRRVEERARLEV
RDLVLVDTAGRLQIDERLMEELVRLKAALRPDEVLLVLDAMTGQEALSVAQAFDERVGVT
GLVLTKLDGDARGGAALSARRVTGKPIYFAGVSERPEGLEPFYPDRLAGRILGMGDVATL
AEKVRQAGLEAEAPKSAKELTLEDFLKQMQNLKRLGSFSELLKLLPGVGRALPQGFQVDE
RAFKRLEAIVLSMTPEERKDPRILNASRRRRIAKGSGTTVQEVNRLVKAFEETKALMKSL
ERRKGRGLMGMFRR
//