[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:AAS81035.1"

            "putative protease/transporter"
            ""

OrgPattern 11---1------------1-1--1------------------------11-----11-111---1--- -----------------------------------------------------------------------------------1--1------1------------1-----------------1----11----1--------11----------------------------------------1111---1---------------111111------11--------11-------------------------------------------------------------------------------------------11-------------------------1---1-------2--111-----11--------------1-------------------------------------1--11-----------------------------------------------------------------------1--------------1--------1111-------------1------1--------------11--1111-----1-----1-1-------1--11-1------------------------------------------------------------1------------------------------------------------------------------------------------------------111111------1--------------------------1-11-11---1-1-11------------1-------------------------------1----------------------------------------------------11- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MGHTFSLRAYRIRAVKRLWALILLLPIALGKTYLVPIEGEIDPALAVFVEQALARAEREG:Sequence : cTTTEEEEcccccHHHHHHHHHHHHHHHHcc:Sec Str : XXXXXXXXXXXX :SEG|18->29|lwalilllpial : ============================:BL:SWS|33->213|YQEZ_BACSU|3e-23|37.3|177/437 61: . . . * . .: 120 :ASGVAFLIDTPGGRVDAAIRISDRILQTPLPTLAVVQNAFSAGALIALSCRQIVMLPGSE:Sequence :cccEEEEEEEccccHHHHHHHHHHHHHccccEEEEEEEEETHHHHHHHTccTTcEcTTcE:Sec Str :============================================================:BL:SWS|33->213|YQEZ_BACSU|3e-23|37.3|177/437 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|64->143|PF01972|6e-06|37.7|77/207|SDH_sah 121: . . + . . .: 180 :IGAALPVVALPLQEPQAADQKVISALKGKFRAVAEARGRPVELAEAMVDPNLEVPGLSAK:Sequence :EEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccHHHHHHHHHHHHHHTTccHH:Sec Str :============================================================:BL:SWS|33->213|YQEZ_BACSU|3e-23|37.3|177/437 :$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|64->143|PF01972|6e-06|37.7|77/207|SDH_sah 181: . * . . . .: 240 :GEPLTLSADKAVELKVADLKAASLYEALQAAGFSPEVERLAPGPRVQVARFLTSSTVAGL:Sequence :HTTcEEEHHHHHHHTcccEEEccHHHHHHHHHHHcccccccTTcccccc :Sec Str : XXXXXXXXX:SEG|232->251|ltsstvaglllalglllllv :================================= :BL:SWS|33->213|YQEZ_BACSU|3e-23|37.3|177/437 241: + . . . . *: 300 :LLALGLLLLLVELFTPGFGVAGALGLAFLALYFAGGWLAGLSGAFELLLFLLGVALLLAE:Sequence : :Sec Str :XXXXXXXXXXX :SEG|232->251|ltsstvaglllalglllllv : XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX:SEG|257->308|gfgvagalglaflalyfaggwlaglsgafelllfllgvalllaeaflfpgfg 301: . . . . + .: 360 :AFLFPGFGIAGVLGVGSILASVYFTFGENALLVLSVAVIALGLGLVLVFRYLPRTRPAQA:Sequence : :Sec Str :XXXXXXXX :SEG|257->308|gfgvagalglaflalyfaggwlaglsgafelllfllgvalllaeaflfpgfg : XXXXXXXXXXXXXXXXXXX :SEG|330->348|allvlsvavialglglvlv 361: . . . * . .: 420 :LVLESAIQGHATEEAVEVGAVGTALTDLRPGGVARFGAKRVDVVANRGFIPKGTPVRVVE:Sequence : :Sec Str : XXXXX:SEG|416->429|vrvvevrgitvvve 421: . . + . . .: 480 :VRGITVVVEPLEE :Sequence : :Sec Str :XXXXXXXXX :SEG|416->429|vrvvevrgitvvve