[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAS81136.1 tthe0 AAS81136.1 "hypothetical protein"
MEKNRYRIKVPGIHGAGCIRRVEQVAGVEKAWMGYPGEAL
//