[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:AAS81141.1"

            "amino acid ABC transporter, ATP-binding protein"
            ""

OrgPattern YYNCRPJKXWWTWSYNoMUQRSUZ*PTnqcjZIBDDECHHIGEXcUYnOT**k9UcTUWNXJKFa1A9 YgvT*jjjrrtbeVZUXPP-PoAAZ*PPPPPOxrst****Z*g****myuoT***VYmCC***n*z****nhccc*ifcS*mvACD9BXVRN5NFHI--GHUNLMcOXTPAAAAAAADDDCCCCHUSLSaQMWYZUu****MMM*h*pr*iioinYaQLQMNMihdp***cMSJLKIJRHMFGqglaXzpBbgw************************jp***mnwwxstv**Xlmmmmjjkllllkkggdaf*ecY**WPdWjwvOP**dXPWnmgefrrtwtqzwzvswrqqnsxottcdcbbdeeefebc*lkfdckjloo***********e*gt***Wgfb*rkus*gtTO**qldhlsVdnfsrRgdhOeYYYOLMMMNgZ***cWu****************-xz*sn*v***YD**************LON**********WVWWWWWW*eiKSjg*55544555553555BC66777955984A5LFIJFF************************t********CP****v*t*******gruQaKWrcIJHIIIISQQizod**Uha*wcuxjhrLgeZWYelYfghhhy*b*MMMQEOOOONHCCCDDDDDDJWHGIRQxvwM*WeKVL*RYabZQaiXUUWYWcYZea5-FMaSL221444****d************-************************mqkuvrttvvvvvstvtts*ytxxxw*b4************35LKFGEFGOPROSN*v*baabcYLRVRQUPViLOPOOETKRYyd********z****q***FFECDEEDFNjsr*stttt*****UVWSRTSOQQHFGF56PWRRMMMMAA899999*DaDDEDA-EAEEGJEQQO9HODGICCCekzYWw*wvuFiQ 1233aRH-ZM5EQWOIHLHKOTMYPYRGGCFFFMLLCMKKIIHDEDHFKPQMaRKHMIGFFFB8A487287589A592789879AC27-PZDHIHH979DB7DHFA5MniwXfZnfeOIIFJXNttE*E**u3xVoKJLBjGOjREQJFEbFD*HbUUwMr*MsPhJ*Ze*TfmPEMMF*BDBJOvgi*D*wDE*h*wY ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MEPIIRIRNLHKWFGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGE:Sequence : =========================================================:RP:SCP|4->244|1b0uA|1e-56|52.3|241/258|c.37.1.12 : =========================================================:BL:SWS|4->243|YHDZ_ECOLI|5e-85|62.5|240/252 : $$$$$$$$$$$$$$$$$:RP:PFM|44->167|PF00005|6e-20|44.2|120/123|ABC_tran 61: . . . * . .: 120 :VVVDGLNVKDDRALREVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPREKAEKKAL:Sequence : XXXXXXXX:SEG|113->124|ekaekkalelle :============================================================:RP:SCP|4->244|1b0uA|1e-56|52.3|241/258|c.37.1.12 :============================================================:BL:SWS|4->243|YHDZ_ECOLI|5e-85|62.5|240/252 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|44->167|PF00005|6e-20|44.2|120/123|ABC_tran 121: . . + . . .: 180 :ELLERVGILDQARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDV:Sequence :XXXX :SEG|113->124|ekaekkalelle : ############### :PROS|139->153|PS00211|ABC_TRANSPORTER_1|PDOC00185| :============================================================:RP:SCP|4->244|1b0uA|1e-56|52.3|241/258|c.37.1.12 :============================================================:BL:SWS|4->243|YHDZ_ECOLI|5e-85|62.5|240/252 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|44->167|PF00005|6e-20|44.2|120/123|ABC_tran 181: . * . . . .: 240 :MRDLAQGGMTMVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEIFTRPKEERTRSFLQR:Sequence :============================================================:RP:SCP|4->244|1b0uA|1e-56|52.3|241/258|c.37.1.12 :============================================================:BL:SWS|4->243|YHDZ_ECOLI|5e-85|62.5|240/252 241: + . . . . *: 300 :VLHH :Sequence :==== :RP:SCP|4->244|1b0uA|1e-56|52.3|241/258|c.37.1.12 :=== :BL:SWS|4->243|YHDZ_ECOLI|5e-85|62.5|240/252