[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAS81141.1 tthe0 AAS81141.1 "amino acid ABC transporter, ATP-binding protein"
MEPIIRIRNLHKWFGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGE
VVVDGLNVKDDRALREVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPREKAEKKAL
ELLERVGILDQARKYPAQLSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDV
MRDLAQGGMTMVVVTHEMGFAREVADRVVFMDGGQIVEEGRPEEIFTRPKEERTRSFLQR
VLHH
//