[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:AAS81265.1"

            "hypothetical protein"
            ""

OrgPattern --------------------------------1----------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------1-------1----11-------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MGVLTRYLEETMAKARYDLVSPGRYVGELAEFGLRVEGENLEATRRALREALELHLLETL:Sequence : XXXXXXXXXXXXXXXXXXXX:SEG|41->65|leatrralrealelhlletlrsgll : ======================================= :RP:SCP|2->40|2dsyA1|7e-07|46.2|39/80|d.304.1.2 61: . . . * . .: 120 :RSGLLPPGLEATPDPLRERFFALAQEMWRLLREAPAPLPRPRKAPSLEEWLKGLGVQVVR:Sequence :XXXXX :SEG|41->65|leatrralrealelhlletlrsgll : XXXXXXXXXXXXXXXXXXX :SEG|89->107|rllreapaplprprkapsl : XXXXX:SEG|116->132|vqvvrrpeegeeererv 121: . . + . . .: 180 :RPEEGEEERERVLNRLALFLGDRYPSLERLYERLKQSLSTKRQFELSLAEASPEEIANST:Sequence :XXXXXXXXXXXX :SEG|116->132|vqvvrrpeegeeererv 181: . * . . . .: 240 :QFCTLLKQYALLTSYRYKSEDRLLRAKASTEGWVQNFLTGGWLERYVAERLRKYLRSKNL:Sequence : $$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|215->333|PF09002|3e-04|34.8|115/353|DUF1887 241: + . . . . *: 300 :PHEVAVGYQVTLPGGEAMELDVLVRVGERFYWFEAKTGEFQAHIAKYAGLKKVLGLSQKE:Sequence :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|215->333|PF09002|3e-04|34.8|115/353|DUF1887 301: . . . . + .: 360 :SFLVLLGMDRARAKELSALHGLTVVNQANFLEAFQEALGAHA :Sequence :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|215->333|PF09002|3e-04|34.8|115/353|DUF1887