[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAS81265.1 tthe0 AAS81265.1 "hypothetical protein"
MGVLTRYLEETMAKARYDLVSPGRYVGELAEFGLRVEGENLEATRRALREALELHLLETL
RSGLLPPGLEATPDPLRERFFALAQEMWRLLREAPAPLPRPRKAPSLEEWLKGLGVQVVR
RPEEGEEERERVLNRLALFLGDRYPSLERLYERLKQSLSTKRQFELSLAEASPEEIANST
QFCTLLKQYALLTSYRYKSEDRLLRAKASTEGWVQNFLTGGWLERYVAERLRKYLRSKNL
PHEVAVGYQVTLPGGEAMELDVLVRVGERFYWFEAKTGEFQAHIAKYAGLKKVLGLSQKE
SFLVLLGMDRARAKELSALHGLTVVNQANFLEAFQEALGAHA
//