[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:AAS81275.1"

            "methionyl-tRNA synthetase"
SYM_THET8   "RecName: Full=Methionyl-tRNA synthetase;         EC=6.1.1.10;AltName: Full=Methionine--tRNA ligase;         Short=MetRS;"

OrgPattern 33323343344443332223223121112112333111111111212222121333444342224212 2131211122121211122-21112122222211111111211112111112111211112211212222111111111141332333111111111-11111111111121222211111111122322223333222222223222221222222221211222211221211211121111323322223333333332233333333333333433343242222223333333333333333333333222322322222222222222222222222222222222322322222222222222222222222222223522222222222232223333133333132222422331343343122121111111111111111111111111111111111-11111111111121111112211122121212121111111111111111113211111111111111111111111111111122222111111111111111111111111111111111111111111111111111111211111111111111111212312321223333222322233224213321111111111111111111121212222111111111111111111111111111111-1111111111111111112222222122-2222222222222222221111111111111111111111111121211121111111111111111111111111111111111111111111111111111111111111112111111111111111-111111222122222221221111111111111111112222221111111112212112-21121212232111231112111111111222 3322334-83325552333333333333325443333323233222333333233333333343333333333443323333333323-33233233222343443145377444642242242543438R4-55543225-3412433242364333443535542446D43435765W6534475693436552224 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----

Master   AminoSeq   


1: . . . . + .: 60 :MEKVFYVTTPIYYVNAEPHLGHAYTTVVADFLARWHRLDGYRTFFLTGTDEHGETVYRAA:Sequence :cccEEEEEcccEETTccccHHHHHHHHHHHHHHHHHHHTTcEEEEEEEEEcccHHHHHHH:Sec Str :============================================================:RP:SCP|1->348|1a8hA2|1e-58|96.8|348/348|c.26.1.1 :============================================================:BL:SWS|1->618|SYM_THET8|0.0|97.4|618/618 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->360|PF09334|8e-88|49.7|346/363|tRNA-synt_1g 61: . . . * . .: 120 :QAAGEDPKAFVDRVSGRFKRAWDLLGIAYDDFIRTTEERHKKVVQLVLKKVYEAGDIYYG:Sequence :HHHTccHHHHHHHHHHHHHHHHHHTTccccEEEETTcHHHHHHHHHHHHHHHHTTcEEEE:Sec Str : XXXXXXXXXXX :SEG|101->111|kkvvqlvlkkv :============================================================:RP:SCP|1->348|1a8hA2|1e-58|96.8|348/348|c.26.1.1 :============================================================:BL:SWS|1->618|SYM_THET8|0.0|97.4|618/618 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->360|PF09334|8e-88|49.7|346/363|tRNA-synt_1g 121: . . + . . .: 180 :EYEGLYCVSCERFYTEKELVEGLCPIHGRPVERRKEGNYFFRMEKYRPWLQEYIQENPDL:Sequence :EEEEEEETTTTEEccTTTccTTccTTTccccEEEEEEEEEEcGGGGHHHHHHHHHTcTTc:Sec Str :============================================================:RP:SCP|1->348|1a8hA2|1e-58|96.8|348/348|c.26.1.1 :============================================================:BL:SWS|1->618|SYM_THET8|0.0|97.4|618/618 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->360|PF09334|8e-88|49.7|346/363|tRNA-synt_1g 181: . * . . . .: 240 :IRPEGYRNEVLAMLAEPIGDLSISRPKSRVPWGIPLPWDENHVTYVWFDALLNYVSALDY:Sequence :EEcHHHHHHHHHHHTcccccEEcEEETTTcccccEETTEEEEEEcHHHHHHTHHHHTTTT:Sec Str :============================================================:RP:SCP|1->348|1a8hA2|1e-58|96.8|348/348|c.26.1.1 :============================================================:BL:SWS|1->618|SYM_THET8|0.0|97.4|618/618 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->360|PF09334|8e-88|49.7|346/363|tRNA-synt_1g 241: + . . . . *: 300 :PEGEAYRTFWPHAWHLIGKDILKPHAVFWPTMLKAAGIPMYRHLNVGGFLLGPDGRKMSK:Sequence :TTcHHHHHHGGGEEEEEEGGGHHHHHTHHHHHHHHHTcccccEEEEEccEEcTTcccccT:Sec Str :============================================================:RP:SCP|1->348|1a8hA2|1e-58|96.8|348/348|c.26.1.1 :============================================================:BL:SWS|1->618|SYM_THET8|0.0|97.4|618/618 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->360|PF09334|8e-88|49.7|346/363|tRNA-synt_1g 301: . . . . + .: 360 :TLGNVVDPFALLEKYGRDALRYYLLREIPYGQDTPVSEEALRTRYEADLADDLGNLVQRT:Sequence :TTTccccHHHHHHHHcHHHHHHHHHHHccTTccEEccHHHHHHHHHHHcccccHHHHHHH:Sec Str :================================================ :RP:SCP|1->348|1a8hA2|1e-58|96.8|348/348|c.26.1.1 : ============:RP:SCP|349->497|1a8hA1|8e-32|99.3|149/152|a.27.1.1 :============================================================:BL:SWS|1->618|SYM_THET8|0.0|97.4|618/618 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->360|PF09334|8e-88|49.7|346/363|tRNA-synt_1g 361: . . . * . .: 420 :RAMLFRFAEGRIPEPVAGEELAEGTGLAKRLRPLVRELKFHVALEEAMAYVKALNRYINE:Sequence :HHHHHHHcTTccccccccGGGGGGGGHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|349->497|1a8hA1|8e-32|99.3|149/152|a.27.1.1 :============================================================:BL:SWS|1->618|SYM_THET8|0.0|97.4|618/618 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|389->475|PF08264|1e-04|34.5|87/153|Anticodon_1 421: . . + . . .: 480 :KKPWELFKKEPEEARAVLYRVVEGLRIASILLTPAMPDKMAELRRALGLKEEVRLEEAER:Sequence :HcHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHTTTcHHHHHHHHHHTTccccccGGGGGc:Sec Str :============================================================:RP:SCP|349->497|1a8hA1|8e-32|99.3|149/152|a.27.1.1 :============================================================:BL:SWS|1->618|SYM_THET8|0.0|97.4|618/618 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|389->475|PF08264|1e-04|34.5|87/153|Anticodon_1 481: . * . . . .: 540 :WGLAEPRPIPEEAPVLFPKKEAKVEAKPKEEAWIGIEDFAKVELRVAEVLAAEKHPNADR:Sequence :cccccccccccccccccHHHHHHHHHHHHHHHHHTTccccHHHHHcccccEEEEETTccc:Sec Str : XXXXXXXXXXXXXXX :SEG|498->512|pkkeakveakpkeea :================= :RP:SCP|349->497|1a8hA1|8e-32|99.3|149/152|a.27.1.1 : ===========================:RP:SCP|514->615|1pxfA|5e-36|35.3|102/111|b.40.4.4 :============================================================:BL:SWS|1->618|SYM_THET8|0.0|97.4|618/618 : $$$$$$$$$$$$$$$$$:RP:PFM|524->614|PF01588|2e-20|53.8|91/100|tRNA_bind 541: + . . . . *: 600 :LLVLRLSLGNEERTVVSGIAKWYRPEELVGKKVVLVANLKPAKLRGIESQGMILAAQEGE:Sequence :cEEEEEEcccccEEEEEccTTTccHHHHTTcEEEEEcccccEEETTEEEccEEcEEEccc:Sec Str :============================================================:RP:SCP|514->615|1pxfA|5e-36|35.3|102/111|b.40.4.4 :============================================================:BL:SWS|1->618|SYM_THET8|0.0|97.4|618/618 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|524->614|PF01588|2e-20|53.8|91/100|tRNA_bind 601: . . . . + .: 660 :ALALVTVEGEVPPGAVVK :Sequence :cEEEccccTTccTTcccG :Sec Str :=============== :RP:SCP|514->615|1pxfA|5e-36|35.3|102/111|b.40.4.4 :================== :BL:SWS|1->618|SYM_THET8|0.0|97.4|618/618 :$$$$$$$$$$$$$$ :RP:PFM|524->614|PF01588|2e-20|53.8|91/100|tRNA_bind