[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:AAS81342.1"

            "conserved hypothetical protein"
            ""

OrgPattern ---------------------------------1111-11111---1------1-------------- 212-111-----1--------1---1------1111-111-1----11-----1-11------1122111-----------12--1111111-111-----1---211-2--------------------------22233----3---111---11---111-1--11-1------------22222---22222222112221211243222211223311-1------211-------------------1---11-------1111-1----111------------------------------------------------------------------------1--2-56-231--33-----1-122---------11-----1-----------------221221212---111---1--1---1----11----1--1111111111111122----------------------------------1-111-2113122222122232222122323332--111--------1---11----111111111111222-2414233232333-3131133-31121---32--21222221222222222111-1--1---1-1--1211111-111111111111----11-1------1-211--1111111111-111111211111111-11----1---2------------------1-1111---------------------------1-1--1111111----1111----------1------11------1----------------2--------11----------------------------------------------------------------------11- -------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRVALFITCLADQFYAEAGVAAVRLLRALGVEVDFPQGQTCCGQPAFNAGYWDEARPLAK:Sequence : XXXXXXXXXXXXXXXXXX :SEG|16->33|aeagvaavrllralgvev :============================================================:BL:SWS|1->230|LUTA2_BACCZ|9e-49|41.5|229/242 61: . . . * . .: 120 :RTLEVFEEAEYVVLPSGSCASMVKNHYPELLPGNREALAMAEKTYELSQFLVRVLGVEKL:Sequence : XXXXXXXXXX:SEG|111->127|lvrvlgveklgeglkgr :============================================================:BL:SWS|1->230|LUTA2_BACCZ|9e-49|41.5|229/242 121: . . + . . .: 180 :GEGLKGRRVAYHHGCHALRELGVREEPLLLLQNAGAEILPWEAWEECCGFGGLFSVKLPE:Sequence :XXXXXXX :SEG|111->127|lvrvlgveklgeglkgr : =============================================:RP:SCP|136->203|2jovA1|2e-13|8.8|68/77|d.349.1.1 :============================================================:BL:SWS|1->230|LUTA2_BACCZ|9e-49|41.5|229/242 181: . * . . . .: 240 :VSLAMADRKLATLPKAEVLTSTDAGCLLHLAGRLGKKGENLRVAPLATLLWEAYAG :Sequence :======================= :RP:SCP|136->203|2jovA1|2e-13|8.8|68/77|d.349.1.1 :================================================== :BL:SWS|1->230|LUTA2_BACCZ|9e-49|41.5|229/242