[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAS81342.1 tthe0 AAS81342.1 "conserved hypothetical protein"
MRVALFITCLADQFYAEAGVAAVRLLRALGVEVDFPQGQTCCGQPAFNAGYWDEARPLAK
RTLEVFEEAEYVVLPSGSCASMVKNHYPELLPGNREALAMAEKTYELSQFLVRVLGVEKL
GEGLKGRRVAYHHGCHALRELGVREEPLLLLQNAGAEILPWEAWEECCGFGGLFSVKLPE
VSLAMADRKLATLPKAEVLTSTDAGCLLHLAGRLGKKGENLRVAPLATLLWEAYAG
//