[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:AAS81487.1"

            "conserved hypothetical protein"
            ""

OrgPattern ------21111111121------------1-1--1----------2----1-113243442------- ----3----------------1---1------11111-111---1----1-----------11-323-1---111-----1-11---------2------------111-------------------------1----121112-11111111111-----11-111111------------11134-----------1---------21-------1---1-1-11-1-131111111111111111--11-1-1--1-111--------------------1-----------------------------------------------------------1-1----2-1----------------------------------11------------------------1--2-----------1-----------11-11-------------------------------------------------------112--1111---------2---------1--1--111--1112---1-------------------1-1-----1----1-----1-1-11-------111-------------------------111--1------------------------------11-2--------1----------------------------------------1-------------------------1--------------------------1---------1-------------------1-1111111-21-1-11-----------1------------------------------------11-------------------------------------1---11111--- ------------------------------------------------------------------------------------------1--11--------111----41111111-2111-111425A2-225111-1-11---1-11--1-11-11-1111212--11111---131-1112445-33-11---- --1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MVRALTFDVGNTLILASPRFWLLPLLEARGLRPRGDVRKAALEAFRFYEENHLKARDLET:Sequence :TccEEEEcccTTTEEcHHHHHHHHHHHHHHTGGGcHHHHHHHHHHHHTTcccccHHHHTT:Sec Str : ===========================================================:RP:SCP|2->216|1x42A1|1e-27|24.2|211/230|c.108.1.1 : ===========================================================:BL:SWS|2->197|HDHD3_BOVIN|5e-24|38.1|194/251 61: . . . * . .: 120 :ALGLWREFHRRLLVGMGLEDHAEALSRELVARWKDPATWPLVPGAEATLKALKAKGYPLA:Sequence :TTccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHGGGcEEcTTHHHHHHHHHHHTcEEE:Sec Str :============================================================:RP:SCP|2->216|1x42A1|1e-27|24.2|211/230|c.108.1.1 :============================================================:BL:SWS|2->197|HDHD3_BOVIN|5e-24|38.1|194/251 121: . . + . . .: 180 :VVSNWDATLPEILEVVGLGRYFDHLSVSALSGYAKPDPRLFREALEALGVSPEEAVHVGD:Sequence :EEccccHHHHHHHHHTccTTcccEEEcGGGccccTTcTHHHHHHHHHTTccGGGEEEEEc:Sec Str :============================================================:RP:SCP|2->216|1x42A1|1e-27|24.2|211/230|c.108.1.1 :============================================================:BL:SWS|2->197|HDHD3_BOVIN|5e-24|38.1|194/251 181: . * . . . .: 240 :AEADLLGAEAVGMRALLFDPLGENPKALPRLERVLDYLP :Sequence :cHHHHHHHHHHTcEEEEccccTccccccccGGGHHHHH :Sec Str :==================================== :RP:SCP|2->216|1x42A1|1e-27|24.2|211/230|c.108.1.1 :================= :BL:SWS|2->197|HDHD3_BOVIN|5e-24|38.1|194/251