[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAS81487.1 tthe0 AAS81487.1 "conserved hypothetical protein"
MVRALTFDVGNTLILASPRFWLLPLLEARGLRPRGDVRKAALEAFRFYEENHLKARDLET
ALGLWREFHRRLLVGMGLEDHAEALSRELVARWKDPATWPLVPGAEATLKALKAKGYPLA
VVSNWDATLPEILEVVGLGRYFDHLSVSALSGYAKPDPRLFREALEALGVSPEEAVHVGD
AEADLLGAEAVGMRALLFDPLGENPKALPRLERVLDYLP
//