[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:AAS81497.1"

            "phosphoribosylformylglycinamidine synthase"
PURL_THET8  "RecName: Full=Phosphoribosylformylglycinamidine synthase 2;         EC=6.3.5.3;AltName: Full=Phosphoribosylformylglycinamidine synthase II;         Short=FGAM synthase II;"

OrgPattern --11--1111111111-111111111111111111111111111111111111111121-1111--11 1111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111---11111-2-111---------------11111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111-11111-1-11111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111-1111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111---------------1111111111-------------------1--------1----11---11---1---1---1121111111111111111111111111111111111111111111111-1111111111111-1-------11111--1111111111111111111111111111111-11111------11111111111111111-1111111111111-111111111111111111111111111111111111111111111111111--111111111111-1-1111111-111111111111111--1111111111111111111111111111111111111111111111------------1111111111--------1---------------------------1-11111111111 -----11-----11-------------111111--------------1111111-----1111-1-11-11-11------1--1--11-----1-1---1-------------1------------1-------------1-11----1----11--1-----2-------1---111------12--11111-21211 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MEALAKEIGIPEGEYREIVQRLGREPNRVELLLFKVMWSEHCAYKNSRPLLKALPKEGEA:Sequence : THHHHHHHHcccccHHHHHHHHHHTccccccTTTHHHHGGGccTTEE:Sec Str : ===============================================:RP:SCP|14->189|1vk3A1|4e-40|50.6|162/165|d.79.4.1 :============================================================:BL:SWS|1->725|PURL_THET8|0.0|100.0|725/725 61: . . . * . .: 120 :VLQGPGENAGVVRVGEGWAVAFKIESHNHPSAVEPFQGAATGVGGILRDIMSMGARPIAL:Sequence :HHccccccTTEEEccccEEEEEEEEEccHHHHHccHHHHHHHHHHHHHHHHTTTcEEEEE:Sec Str :============================================================:RP:SCP|14->189|1vk3A1|4e-40|50.6|162/165|d.79.4.1 :============================================================:BL:SWS|1->725|PURL_THET8|0.0|100.0|725/725 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|66->160|PF00586|2e-15|47.8|92/97|AIRS 121: . . + . . .: 180 :LDSLRFGPPEEARSRYLLKGVVSGIAFYGNAIGVPTVGGDLYFHEGYRENPLVNAMCLGL:Sequence :EEEEEEccccHHHcccccHHHHHHHHHHHGGGTccEEEEEEEEcTTcTTccEEEEEEEEE:Sec Str :============================================================:RP:SCP|14->189|1vk3A1|4e-40|50.6|162/165|d.79.4.1 :============================================================:BL:SWS|1->725|PURL_THET8|0.0|100.0|725/725 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|66->160|PF00586|2e-15|47.8|92/97|AIRS 181: . * . . . .: 240 :LREEHLKRSRASLGRPIYYAGAKTGRDGIGGAAFASRELKEEKAEDRPAVQVGDPFLGKL:Sequence :EEGGGccccccccccEEEEEEccccccccccHHHHHHHHHccccccccccccccHHHHHH:Sec Str :========= :RP:SCP|14->189|1vk3A1|4e-40|50.6|162/165|d.79.4.1 : ===============================================:RP:SCP|194->368|1t3tA6|7e-36|22.3|157/168|d.139.1.1 :============================================================:BL:SWS|1->725|PURL_THET8|0.0|100.0|725/725 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|204->320|PF02769|4e-07|40.4|114/148|AIRS_C 241: + . . . . *: 300 :LMEATLEAIELDLVEGVQDMGAAGLTSSLSELAHKSGLGVELHLDLVPTREEGMTPEELL:Sequence :HHHHHHHHHHTTcccEEEEccccTHHHHHTHHHHTTTcEEEEEGGGcccccTTccHHHHH:Sec Str :============================================================:RP:SCP|194->368|1t3tA6|7e-36|22.3|157/168|d.139.1.1 :============================================================:BL:SWS|1->725|PURL_THET8|0.0|100.0|725/725 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|204->320|PF02769|4e-07|40.4|114/148|AIRS_C 301: . . . . + .: 360 :LSESQERMVLVPKEGKEKALEEVFGRWGLDCVPVARTIPERVFRVLFRGEVVAEVPTEAL:Sequence :ccccccEEEEEEcTTccTTHHHHHHHTTcEEEEEEEEEcccEEEEEETTEEEEEEETHHH:Sec Str :============================================================:RP:SCP|194->368|1t3tA6|7e-36|22.3|157/168|d.139.1.1 :============================================================:BL:SWS|1->725|PURL_THET8|0.0|100.0|725/725 :$$$$$$$$$$$$$$$$$$$$ :RP:PFM|204->320|PF02769|4e-07|40.4|114/148|AIRS_C 361: . . . * . .: 420 :AEAPTYVRVGREDPEVRRLRETPIPPLEADPQEVLRRLLASPNLASREAVYERYDHQVGT:Sequence :HccccccccccccHHHEEEEEEcHHHcccccccccccccccccccccHHHHTTccccTTc:Sec Str :======== :RP:SCP|194->368|1t3tA6|7e-36|22.3|157/168|d.139.1.1 : ========================:RP:SCP|397->551|1vk3A2|4e-44|39.3|150/162|d.79.4.1 :============================================================:BL:SWS|1->725|PURL_THET8|0.0|100.0|725/725 421: . . + . . .: 480 :RTALLPGKGDAAVLWIKGTRLGVAAKVDQNPRYSRLHPRLGAMHALAEACRNVSVVGAKP:Sequence :cccccTTEcccEEcccTTccEEEEEEEEccHHHHHHcTTHHHHHHHHHHHHHHHTTTcEE:Sec Str :============================================================:RP:SCP|397->551|1vk3A2|4e-44|39.3|150/162|d.79.4.1 :============================================================:BL:SWS|1->725|PURL_THET8|0.0|100.0|725/725 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|427->522|PF00586|9e-05|35.6|90/97|AIRS 481: . * . . . .: 540 :LAYTDGLNLGSPETPEGYHELAETIAGLKEASEALGVPVVSGNVSLYNESGGKRIPPTAM:Sequence :EEEEccEEcccTTTcHHHHHHHHHHHHHHHHHHHccccEEEcccccccEETTEEcccEEc:Sec Str :============================================================:RP:SCP|397->551|1vk3A2|4e-44|39.3|150/162|d.79.4.1 :============================================================:BL:SWS|1->725|PURL_THET8|0.0|100.0|725/725 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|427->522|PF00586|9e-05|35.6|90/97|AIRS 541: + . . . . *: 600 :VGVVGVLEVDKRAEMGFRRPGEVLLLIGEERGELGASEVLYLLTGKEFGHPPRLDLGREK:Sequence :EEEEEEEcTTcccccTTccTTcEEEEEEccccTccccEEEEEEHcccccccccEEccccG:Sec Str : XXXXXXXXXXXXXXX :SEG|561->575|gevllligeergelg :=========== :RP:SCP|397->551|1vk3A2|4e-44|39.3|150/162|d.79.4.1 :============================================================:BL:SWS|1->725|PURL_THET8|0.0|100.0|725/725 601: . . . . + .: 660 :AVQEAIRDLIQRGLTRTAHDVAEGGLLLALAEMTFPYGVGATVEVREEGLEALFGEAPSR:Sequence :GGcHHHHHHHHHHHTTTcEEEccTTcccHHHHHHHTTTcEEEEcccccEEEEEEEccccc:Sec Str : XXXXXXXXXXX :SEG|622->632|aegglllalae : =========================================================:RP:SCP|604->702|1t3tA6|1e-08|19.4|99/168|d.139.1.1 :============================================================:BL:SWS|1->725|PURL_THET8|0.0|100.0|725/725 661: . . . * . .: 720 :VLFTVEKTRLQEATLLLEERGLPYRVLGETGGKSLTVLTPGGVLEWSLEELLSAWKAPLR:Sequence :ccccEETTTHHHHHHHHHHHTccEEEEEEEEcccEEEE :Sec Str : XXXXXXXXXX :SEG|704->713|lewsleells :========================================== :RP:SCP|604->702|1t3tA6|1e-08|19.4|99/168|d.139.1.1 :============================================================:BL:SWS|1->725|PURL_THET8|0.0|100.0|725/725 721: . . + . . .: 780 :EVLDG :Sequence : :Sec Str :===== :BL:SWS|1->725|PURL_THET8|0.0|100.0|725/725