[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:AAS81529.1"

            "GMP synthase"
GUAA_THET2  "RecName: Full=GMP synthase [glutamine-hydrolyzing];         EC=6.3.5.2;AltName: Full=Glutamine amidotransferase;AltName: Full=GMP synthetase;"

OrgPattern 2213--3233333323-322222343334355333333333332123323333333223222331-22 2211242222312122211-1122121111111222124211111211222222222122111111223311111222112222212222322311-11111121211311-------1111111222322222222222222212223222232333232222222223222222222222233333221222333333332333333222222333222323333333322222222222222222233121111111-1112211111111113332222222222222222222222222222222222211222111123123111111111122322222212122222233322121323222121222333311111343112132111233333333333-44344443223122222222222223242222222313222222222222132221111111111---------------111113232322222222222322222222222222222222222222222222222332222222222222222222222133432222222221323222232222334352222222222222222222222222223332322233333333333333333333342-22322-1----33443333333333333-333333333333333333335344333333233333333333333333333213323333233331123221222222222321111221222232222222222222222232222322222222222222322223333222223332222333333333323222122222211111-1-1------1-------------1------1-21121222233 11-1111-311-1222212122213221112222122132223222212322322222222222222222222222212222222222-23222141111312222-2412111111112111112-11251-11211111-11-1111-1111111112651111111113322211191111233432821154221 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MVLVLDFGSQYTRLIARRLRELRAFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDA:Sequence :cEEEEEccccTTcHHHHHHHHTTccccEEETTccGGGGHTTTccEEEEccccGGGTGGGH:Sec Str : XXXXXXXXXXXX :SEG|13->24|rliarrlrelra : ===========================================================:RP:SCP|2->187|1gpmA2|5e-36|40.9|186/205|c.23.16.1 :============================================================:BL:SWS|1->503|GUAA_THET2|0.0|100.0|503/503 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|28->183|PF00117|6e-24|38.5|156/185|GATase 61: . . . * . .: 120 :PRPDPRLFSSGLPLLGICYGMQLLAQELGGRVERAGRAEYGKALLTRHEGPLFRGLEGEV:Sequence :HHHHHHHHHccccEEEETHHHHHHHHHTTcEEEEEEEEEEEEEEEEEcccGGGTTcccEE:Sec Str :============================================================:RP:SCP|2->187|1gpmA2|5e-36|40.9|186/205|c.23.16.1 :============================================================:BL:SWS|1->503|GUAA_THET2|0.0|100.0|503/503 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|28->183|PF00117|6e-24|38.5|156/185|GATase 121: . . + . . .: 180 :QVWMSHQDAVTAPPPGWRVVAETEENPVAAIASPDGRAYGVQFHPEVAHTPKGMQILENF:Sequence :EEEEEEEEEEEcccTTEEEEEEcccccccEEEEccccEEEEcccTTcTTcTTHHHHHHHH:Sec Str :============================================================:RP:SCP|2->187|1gpmA2|5e-36|40.9|186/205|c.23.16.1 :============================================================:BL:SWS|1->503|GUAA_THET2|0.0|100.0|503/503 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|28->183|PF00117|6e-24|38.5|156/185|GATase 181: . * . . . .: 240 :LELAGAKRDWTPEHVLEELLREVRERAGKDRVLLAVSGGVDSSTLALLLAKAGVDHLAVF:Sequence :HHHHHHHHHHHHHcHHHHHHHHHHHHHHHcEEEEEccccHHHHHHHHHHHHHHHHTTccG:Sec Str : XXXXXXXXXXXX :SEG|195->206|vleellrevrer :======= :RP:SCP|2->187|1gpmA2|5e-36|40.9|186/205|c.23.16.1 : ===================================================:RP:SCP|190->328|1gpmA1|2e-16|43.2|139/175|c.26.2.1 :============================================================:BL:SWS|1->503|GUAA_THET2|0.0|100.0|503/503 :$$$ :RP:PFM|28->183|PF00117|6e-24|38.5|156/185|GATase : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|211->241|PF03054|9e-04|51.6|31/348|tRNA_Me_trans 241: + . . . . *: 300 :VDHGLLRLGEREEVEGALRALGVNLLVVDAKERFLKALKGVEDPEEKRKIIGREFVAAFS:Sequence :GGEEEEEcccccHHHHHHHHHTcEEEEccTHHHHHHHHHHTTcGGGGTcccccHHHHHHH:Sec Str : XXXXXXXXXXXXXXXXXX :SEG|244->261|gllrlgereevegalral :============================================================:RP:SCP|190->328|1gpmA1|2e-16|43.2|139/175|c.26.2.1 :============================================================:BL:SWS|1->503|GUAA_THET2|0.0|100.0|503/503 :$ :RP:PFM|211->241|PF03054|9e-04|51.6|31/348|tRNA_Me_trans 301: . . . . + .: 360 :QVARERGPFRFLAQGTLYPDVIESAGGHGAAKIKSHHNVGGLPEDLEFELLEPFRLLFKD:Sequence :HHHHHHHHHHHHHHHHHTEEEEEcccHHHHHHTcccccccTccccTTcccEEccTTccHH:Sec Str : XXXXXXXXXXXXXXXXX :SEG|342->358|lpedlefellepfrllf :============================ :RP:SCP|190->328|1gpmA1|2e-16|43.2|139/175|c.26.2.1 :============================================================:BL:SWS|1->503|GUAA_THET2|0.0|100.0|503/503 361: . . . * . .: 420 :EVRELALLLGLPDTLRLRHPFPGPGLAVRVLGEVTEERLEILRRADDIFTSLLREWGLYE:Sequence :HHHHHHHHHHHHccccHHHHHHHHHHHHHccTTcccHHHHHHHHHHHHHHHcccHHHHHH:Sec Str : XXXXXXXXXXXXX :SEG|365->377|lalllglpdtlrl : ======================================:RP:SCP|383->503|1gpmA3|2e-24|62.0|121/121|d.52.2.1 :============================================================:BL:SWS|1->503|GUAA_THET2|0.0|100.0|503/503 : $$$$$$$$$:RP:PFM|412->502|PF00958|3e-30|62.6|91/93|GMP_synt_C 421: . . + . . .: 480 :KVAQALAVLTPVRSVGVAGDERKYGYVLALRAVTTEDFMTADWARLPLEFLDEAARRITR:Sequence :HHHHHHccTTcccccTTccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHTTcHHHHH:Sec Str :============================================================:RP:SCP|383->503|1gpmA3|2e-24|62.0|121/121|d.52.2.1 :============================================================:BL:SWS|1->503|GUAA_THET2|0.0|100.0|503/503 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|412->502|PF00958|3e-30|62.6|91/93|GMP_synt_C 481: . * . . . .: 540 :RVPEIGRVVYDLTSKPPATIEWE :Sequence :TccccccccTTccccTTTTHHHH :Sec Str :======================= :RP:SCP|383->503|1gpmA3|2e-24|62.0|121/121|d.52.2.1 :======================= :BL:SWS|1->503|GUAA_THET2|0.0|100.0|503/503 :$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|412->502|PF00958|3e-30|62.6|91/93|GMP_synt_C