[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:AAS81530.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------4--------------------------1----1----2-1A36CCG-111------93147972--------------244----1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------1---1----1--1------------33132132---------------------------------------------3--------------------------------------------------------------------------3---1-2------1------------------------------------------------9-------------------------1--------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MGEPARLRRLTAEEYLREEATSPVKRELVEGVPYAMAGAGRAHNLIVTNLVLLLGPLARR:Sequence : =====================================================:RP:SCP|8->177|1wdjA|6e-22|20.7|169/186|c.52.1.27 : ================================================:BL:SWS|13->182|Y925_SYNY3|1e-26|40.0|170/202 61: . . . * . .: 120 :KGGRLYVADMKLKVGEATFYYPDLMAVCAPPPESPLYEEAPCLVVEVLSPATEGVDRREK:Sequence :============================================================:RP:SCP|8->177|1wdjA|6e-22|20.7|169/186|c.52.1.27 :============================================================:BL:SWS|13->182|Y925_SYNY3|1e-26|40.0|170/202 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|82->146|PF05685|9e-05|46.9|64/112|DUF820 121: . . + . . .: 180 :LWRYLSLPSLEGYLLVSARERRVELYRKEGDILHQVAEEGEVPLPCLEGSLPVAEVYAGV:Sequence :========================================================= :RP:SCP|8->177|1wdjA|6e-22|20.7|169/186|c.52.1.27 :============================================================:BL:SWS|13->182|Y925_SYNY3|1e-26|40.0|170/202 :$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|82->146|PF05685|9e-05|46.9|64/112|DUF820 181: . * . . . .: 240 :ELEGQEA :Sequence :== :BL:SWS|13->182|Y925_SYNY3|1e-26|40.0|170/202