[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAS81530.1 tthe0 AAS81530.1 "conserved hypothetical protein"
MGEPARLRRLTAEEYLREEATSPVKRELVEGVPYAMAGAGRAHNLIVTNLVLLLGPLARR
KGGRLYVADMKLKVGEATFYYPDLMAVCAPPPESPLYEEAPCLVVEVLSPATEGVDRREK
LWRYLSLPSLEGYLLVSARERRVELYRKEGDILHQVAEEGEVPLPCLEGSLPVAEVYAGV
ELEGQEA
//