[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:AAS81541.1"

            "putative methylated-DNA-protein-cysteine methyltransferase"
            ""

OrgPattern 11---11-111111111---------------1----------1111--11--1---1111---1--- -11-2---1111---1111-1211-211111-21111----211121111112-----11---1--231-11---111-1111-----11---1--1----1-112-1-1--------1--------111---1--111111111---------------------111-----------------1111111111111-111111111-1--11111---111-2-11121-111111111111111---11111----1--11111--111------111111111111111111111-------------1111--1111--2---------1-1--11----1111-----1112-111111--1-----1-1--2-----1-311---2222111111111111---1-----11--211122122112--1---1-1-111-1111111112---11-1------------1-----------------1-2-12--112111121111111231-1111222222211222---1--1211111-1---21-------111---111-1---1------111-1111---1-121------------111111111----1111111--1-111-11-1-----------------11--------11111--111-1111-1-111111111111111111----11111----------------11111111--111111111111---1-2--11111---1-111111111111111------111--1----112-1-1-1-----------------111111-111111-1-11---------1----------------11------------------1-----------11111112 ----1----------1-1-1111---11-1----------------1111--1-111--------------------------------------------------1--------------111----------1----2-1-1-1---1-------1-----1-----------1------1-----1----11--- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----

Master   AminoSeq   


1: . . . . + .: 60 :MWVPTPLGPLWLEVSPLGVRRLEPALYPRGPEAEGALALKVREAVQAYFAGERPDFLDLP:Sequence : EEccTTccEEEEEETTEEEEEcccccccccccccHHHHHHHHHHHHHHHcGGGGGcccH:Sec Str : ===========================================================:RP:SCP|2->68|1eh6A2|2e-06|16.7|66/78|c.55.7.1 : =============:BL:SWS|48->147|OGT_METS5|3e-17|45.9|98/156 61: . . . * . .: 120 :LDYTGLSPARLRLYERVRLVPYGRTVSYGALGRELGLSPRAVGAALRACPFFLLVPAHRV:Sequence :HHHccccHHHHHHHHHHHHccTTccEEHHHHHHHTTccHHHHHHHTTcccccTTccGGGE:Sec Str :======== :RP:SCP|2->68|1eh6A2|2e-06|16.7|66/78|c.55.7.1 : ======================================================:RP:SCP|67->146|1eh6A1|2e-20|37.5|80/90|a.4.2.1 :============================================================:BL:SWS|48->147|OGT_METS5|3e-17|45.9|98/156 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|68->145|PF01035|1e-10|44.9|78/85|DNA_binding_1 121: . . + . . .: 180 :IHADGRLGGFQGQEGLKLWLLRFEGAL :Sequence :EcTTccccccTTcHHHHHHHHHHTTc :Sec Str :========================== :RP:SCP|67->146|1eh6A1|2e-20|37.5|80/90|a.4.2.1 :=========================== :BL:SWS|48->147|OGT_METS5|3e-17|45.9|98/156 :$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|68->145|PF01035|1e-10|44.9|78/85|DNA_binding_1