[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAS81541.1 tthe0 AAS81541.1 "putative methylated-DNA-protein-cysteine methyltransferase"
MWVPTPLGPLWLEVSPLGVRRLEPALYPRGPEAEGALALKVREAVQAYFAGERPDFLDLP
LDYTGLSPARLRLYERVRLVPYGRTVSYGALGRELGLSPRAVGAALRACPFFLLVPAHRV
IHADGRLGGFQGQEGLKLWLLRFEGAL
//