[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:AAS81542.1"

            "stage II sporulation protein D"
            ""

OrgPattern -------------------------------------------------------------------- -111--------------------------------11--1---11----------------2---------------------------------------------1-------------------------------------333333334332323232312222222212223212211111112-2211111111111111112222211112111--------22------------------------------------------------------------------------------------------23321111111111121111111212--2112122223242333332-1-11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1---1--1----1111111-122222-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKRLLAWVGLLALVLAALGQKAPGLEALLVRVLLKEVALGEEVRLALPTGEVALRGQAEG:Sequence : :Sec Str : XXXXXXXXXXXXXXXX :SEG|4->19|llawvgllalvlaalg : ===================================:BL:SWS|26->338|Y0569_BRAHW|2e-34|34.2|301/368 61: . . . * . .: 120 :VVVEGRPLPSWAVEGPYFALEGRPYRGGLVARVEGGRLLLVNVLPLEDYLLGVLPAEMPA:Sequence : :Sec Str :============================================================:BL:SWS|26->338|Y0569_BRAHW|2e-34|34.2|301/368 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|93->182|PF08486|5e-23|60.0|90/96|SpoIID 121: . . + . . .: 180 :SFPEEALKAQAVLARTFAVRRLNPLAPYDLCATEACQVYLGLSAETPRHERAVRATEGRV:Sequence : :Sec Str :============================================================:BL:SWS|26->338|Y0569_BRAHW|2e-34|34.2|301/368 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|93->182|PF08486|5e-23|60.0|90/96|SpoIID 181: . * . . . .: 240 :LSYAGQVASALYHADSGGMTAGSEEVFQKALPYLRPRPDPYAKGPKSVWQQAVRPEEAAR:Sequence : :Sec Str : XXXXXXX:SEG|234->251|rpeeaaralralgyaprg :============================================================:BL:SWS|26->338|Y0569_BRAHW|2e-34|34.2|301/368 :$$ :RP:PFM|93->182|PF08486|5e-23|60.0|90/96|SpoIID 241: + . . . . *: 300 :ALRALGYAPRGDDPPQVLEKSPSGRAWRVRLLGVEVRGPEAQRLLRLMGLPSAMAEFQGW:Sequence : cccccEEEEcTTccEE EEEEEccccHHHHHHHHHHEEEEE E:Sec Str :XXXXXXXXXXX :SEG|234->251|rpeeaaralralgyaprg :============================================================:BL:SWS|26->338|Y0569_BRAHW|2e-34|34.2|301/368 301: . . . . + .: 360 :LALGRGAGHGVGLSQWGAKGMAERGYGYREILGYYFPGTLLSPLEVAAR :Sequence :EEccHHHHH HH HHTTHHHHTTcTTEEEEEcc :Sec Str :====================================== :BL:SWS|26->338|Y0569_BRAHW|2e-34|34.2|301/368