[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAS81542.1 tthe0 AAS81542.1 "stage II sporulation protein D"
MKRLLAWVGLLALVLAALGQKAPGLEALLVRVLLKEVALGEEVRLALPTGEVALRGQAEG
VVVEGRPLPSWAVEGPYFALEGRPYRGGLVARVEGGRLLLVNVLPLEDYLLGVLPAEMPA
SFPEEALKAQAVLARTFAVRRLNPLAPYDLCATEACQVYLGLSAETPRHERAVRATEGRV
LSYAGQVASALYHADSGGMTAGSEEVFQKALPYLRPRPDPYAKGPKSVWQQAVRPEEAAR
ALRALGYAPRGDDPPQVLEKSPSGRAWRVRLLGVEVRGPEAQRLLRLMGLPSAMAEFQGW
LALGRGAGHGVGLSQWGAKGMAERGYGYREILGYYFPGTLLSPLEVAAR
//