[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:AAS81546.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MPDELRLFLKERFGVQGPLSPGRFEAELAKRLGSPARRAPLLKAWRAYLAQGGREAVRSF:Sequence : HHHHHHHHHTTTTcc cHHHHHHHHHHHHHTccHHHHHHTTTccccHHHHHHHHHT:Sec Str : ================:RP:SCP|45->206|1xtpA|3e-08|24.8|145/247|c.66.1.42 61: . . . * . .: 120 :YREVLKVPKGEALVYGMHLPHLEFYAKELPPRVEGRVLEVGAFTGALVGFLQRKRPDLEW:Sequence :cccccHHHHHHHHHccHHHHHHHHHHHHccccTTcEEEEETcTTcHHHHHHHHHccccEE:Sec Str :============================================================:RP:SCP|45->206|1xtpA|3e-08|24.8|145/247|c.66.1.42 : ================================:BL:SWS|89->205|Y3374_MYCBO|2e-04|35.7|98/243 121: . . + . . .: 180 :HALDGVEEAVALGKKRVPEVAWHLGWAEEVELPPFDTLLLLSVFPEGLVDQGLESRLAPE:Sequence :EEEEccTTTccccTTcEEEccccccEEEEEEcccccccccHHHHHHHHHHHHHHcTTccT:Sec Str :============================================================:RP:SCP|45->206|1xtpA|3e-08|24.8|145/247|c.66.1.42 :============================================================:BL:SWS|89->205|Y3374_MYCBO|2e-04|35.7|98/243 181: . * . . . .: 240 :AFWKRFAFFERLPLFARLLRPGGLLVYGHGPFLGKSPEGVEEGLRRLGFDRVERVGEGEY:Sequence :TccHHHHHHHHHHHHHHTEEEEEEEEEEEEGGGGEETcGGGHHHHHHHHHHcEEEccTTc:Sec Str :========================== :RP:SCP|45->206|1xtpA|3e-08|24.8|145/247|c.66.1.42 :========================= :BL:SWS|89->205|Y3374_MYCBO|2e-04|35.7|98/243 : =========================================== :BL:SWS|186->228|HACB_THET2|8e-05|46.5|43/163 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|190->247|PF06325|5e-04|40.0|55/245|PrmA 241: + . . . . *: 300 :FLVLARKPEALAAVRLEEREAPPPEEAEEVAVALEEARALLEAGRYAEALALLPEEAEGE:Sequence :cEEEEEE :Sec Str : XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX:SEG|248->304|pealaavrleereapppeeaeevavaleearalleagryaealallpeeaegeaayl :$$$$$$$ :RP:PFM|190->247|PF06325|5e-04|40.0|55/245|PrmA 301: . . . . + .: 360 :AAYLRGRALFALSRHAEAEEALRRALSEEAEDLRALALVELGEYERARGRLEALAVRGGR:Sequence : :Sec Str :XXXX :SEG|248->304|pealaavrleereapppeeaeevavaleearalleagryaealallpeeaegeaayl : XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|311->341|alsrhaeaeealrralseeaedlralalvel : =:BL:SWS|360->421|YCIM_ECOLI|5e-04|32.8|61/389 361: . . . * . .: 420 :YRLALGRVYLAQGRYADALRQFVESGLPEADLYTRETLERITERMRRFAREGEWAEVSRR:Sequence : :Sec Str :============================================================:BL:SWS|360->421|YCIM_ECOLI|5e-04|32.8|61/389 421: . . + . . .: 480 :AEFVEDLSPGLLTREMLRLGLRAALIQGLFARAERYARRLADLDEAEGFLGLALAALRVK:Sequence : :Sec Str : XXXXXXXXXXXXX :SEG|465->477|eaegflglalaal := :BL:SWS|360->421|YCIM_ECOLI|5e-04|32.8|61/389 481: . * . . . .: 540 :SPLELRGGEDLKAVEPYLTEALSRAEIPEALLLLGVLREREGRFREALHLLERAAFRGEG:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXX :SEG|509->526|eallllgvlreregrfre 541: + . . . . *: 600 :EVAGMAYHHLAQVKRALRRPLKEVLGDHKRAHALRAYPAPYLFRLAQEALEGGEEVLARE:Sequence : HHHHHHHHHHHTTc HHHHHHHHHHHHHHcTTcHHHHHHHHHHHHHTTcHHHHHH:Sec Str : ==================================:RP:SCP|567->730|1qsaA1|1e-07|9.8|164/450|a.118.5.1 : ===:BL:SWS|598->733|NPHP3_HUMAN|4e-04|32.3|127/1330 601: . . . . + .: 660 :LLSRARDAGLEAVAEEDLTGLIHLLERLEGPWAAFSVLYQALSRTPQPPLELLALAYRLS:Sequence :HHHHHcHHHHHHHHHHHHHHTTcTTcccHHHHHHHHHHHHHHTcHHHHHHcTTHHHHHHH:Sec Str :============================================================:RP:SCP|567->730|1qsaA1|1e-07|9.8|164/450|a.118.5.1 :============================================================:BL:SWS|598->733|NPHP3_HUMAN|4e-04|32.3|127/1330 661: . . . * . .: 720 :RAFRESPEAETARGQYLAALYAAGRAEEVGRLLEEELKAHPQALEVLFDLAEHHEAQGDW:Sequence :HHHTTcHHHHHHHHHHccccccGGGTccccHHHHHHHHHHHTcHHHHHHHHHHHHHTTcH:Sec Str :============================================================:RP:SCP|567->730|1qsaA1|1e-07|9.8|164/450|a.118.5.1 : ================:RP:SCP|705->778|1ouvA|2e-04|10.0|70/265|a.118.18.1 :============================================================:BL:SWS|598->733|NPHP3_HUMAN|4e-04|32.3|127/1330 721: . . + . . .: 780 :RRAAEFWQKALEVALYREKDLALAREILRNLLFLRPHDESLALYLEELKAVGEGLKALGE:Sequence :HHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHcHHHHHHHHH:Sec Str :========== :RP:SCP|567->730|1qsaA1|1e-07|9.8|164/450|a.118.5.1 :========================================================== :RP:SCP|705->778|1ouvA|2e-04|10.0|70/265|a.118.18.1 :============= :BL:SWS|598->733|NPHP3_HUMAN|4e-04|32.3|127/1330 781: . * . . . .: 840 :EAPHLPEAPRDLLEEDLPRFHGEHLVVVGGHTQLRSRLVPFLEGRGLRVDWYDADTVGVG:Sequence :HHccHHHHHcEE :Sec Str : ===============================:RP:SCP|810->887|1vjpA2|5e-05|20.0|65/107|d.81.1.3 841: + . . . . *: 900 :KEALRRILNRLEKAHGLMIVSSYVGHDLSEPVRLEAERLGVPVHVIPGRARGTTGFLRAL:Sequence : :Sec Str :=============================================== :RP:SCP|810->887|1vjpA2|5e-05|20.0|65/107|d.81.1.3 901: . . . . + .: 960 :KQFAPEVLKRALKGVE :Sequence : :Sec Str