[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAS81546.1 tthe0 AAS81546.1 "hypothetical protein"
MPDELRLFLKERFGVQGPLSPGRFEAELAKRLGSPARRAPLLKAWRAYLAQGGREAVRSF
YREVLKVPKGEALVYGMHLPHLEFYAKELPPRVEGRVLEVGAFTGALVGFLQRKRPDLEW
HALDGVEEAVALGKKRVPEVAWHLGWAEEVELPPFDTLLLLSVFPEGLVDQGLESRLAPE
AFWKRFAFFERLPLFARLLRPGGLLVYGHGPFLGKSPEGVEEGLRRLGFDRVERVGEGEY
FLVLARKPEALAAVRLEEREAPPPEEAEEVAVALEEARALLEAGRYAEALALLPEEAEGE
AAYLRGRALFALSRHAEAEEALRRALSEEAEDLRALALVELGEYERARGRLEALAVRGGR
YRLALGRVYLAQGRYADALRQFVESGLPEADLYTRETLERITERMRRFAREGEWAEVSRR
AEFVEDLSPGLLTREMLRLGLRAALIQGLFARAERYARRLADLDEAEGFLGLALAALRVK
SPLELRGGEDLKAVEPYLTEALSRAEIPEALLLLGVLREREGRFREALHLLERAAFRGEG
EVAGMAYHHLAQVKRALRRPLKEVLGDHKRAHALRAYPAPYLFRLAQEALEGGEEVLARE
LLSRARDAGLEAVAEEDLTGLIHLLERLEGPWAAFSVLYQALSRTPQPPLELLALAYRLS
RAFRESPEAETARGQYLAALYAAGRAEEVGRLLEEELKAHPQALEVLFDLAEHHEAQGDW
RRAAEFWQKALEVALYREKDLALAREILRNLLFLRPHDESLALYLEELKAVGEGLKALGE
EAPHLPEAPRDLLEEDLPRFHGEHLVVVGGHTQLRSRLVPFLEGRGLRVDWYDADTVGVG
KEALRRILNRLEKAHGLMIVSSYVGHDLSEPVRLEAERLGVPVHVIPGRARGTTGFLRAL
KQFAPEVLKRALKGVE
//