[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:AAS81585.1"

            "probable thymidylate kinase"
KTHY_THET8  "RecName: Full=Thymidylate kinase;         EC=2.7.4.9;AltName: Full=dTMP kinase;"

OrgPattern 111-1-22222222221111111111111111-1111-1-111111111111111111111-111--- 11211-----------------------------------121111111111111111111211---111111111111111111111--------------------1-1111111111111111111111111111111111111--1---11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1----------1---1------111--11--1111111111111--111111111112111111111111111111111111-11112111111111111111111111111111111111111111111111111-11111111111111111113111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111311221221111111-------11111111111111111111111111111111111111111111111-1111111-11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111-1--------1114D421-111111111111111111111-1111111111 1-------------11-----1-----111111------------1111111111111111111----------------------11---1---111111-1---1----2211-----11-----1---------1----------1----1-1-11-21-1-3-1-----1111-------11--1-21---1--2 ---------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MPGLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGGLPEVRSLLLTQELSPEA:Sequence :GEEEEEEEcccccccHHHHHHcccccEEEEcccHHHHHTTccccHHHHHHHHHHHHHHHH:Sec Str : ==========================================================:RP:SCP|3->198|1e2dA|3e-51|28.4|190/209|c.37.1.1 :============================================================:BL:SWS|1->198|KTHY_THET8|e-110|100.0|198/198 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|9->185|PF02223|2e-38|59.3|177/188|Thymidylate_kin 61: . . . * . .: 120 :EYLLFSADRAEHVRKVILPGLAAGKVVISDRYLDSSLAYQGYGRGLPLPWLREVAREATR:Sequence :HHHHHHHHHHHHHGGGEEEEEEccEEEEEEccTHHHHTHHHHTTcccHHHHHHHHHTccc:Sec Str : ############# :PROS|88->100|PS01331|THYMIDYLATE_KINASE|PDOC01034| :============================================================:RP:SCP|3->198|1e2dA|3e-51|28.4|190/209|c.37.1.1 :============================================================:BL:SWS|1->198|KTHY_THET8|e-110|100.0|198/198 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|9->185|PF02223|2e-38|59.3|177/188|Thymidylate_kin 121: . . + . . .: 180 :GLKPRLTFLLDLPPEAALRRVRRPDRLEGLGLEFFRRVREGYLALARAEPGRFVVLDATL:Sequence :ccTTcEEEEEEccHHHHHHHHTTccTTccccHHHHHHHHHHHHHHHHHHTTccHHHHGGG:Sec Str :============================================================:RP:SCP|3->198|1e2dA|3e-51|28.4|190/209|c.37.1.1 :============================================================:BL:SWS|1->198|KTHY_THET8|e-110|100.0|198/198 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|9->185|PF02223|2e-38|59.3|177/188|Thymidylate_kin 181: . * . . . .: 240 :PEEEIARAIQAHLRPLLP :Sequence :GTcccccGGGcGGGGGH :Sec Str :================== :RP:SCP|3->198|1e2dA|3e-51|28.4|190/209|c.37.1.1 :================== :BL:SWS|1->198|KTHY_THET8|e-110|100.0|198/198 :$$$$$ :RP:PFM|9->185|PF02223|2e-38|59.3|177/188|Thymidylate_kin