[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAS81585.1 tthe0 AAS81585.1 "probable thymidylate kinase"
MPGLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGGLPEVRSLLLTQELSPEA
EYLLFSADRAEHVRKVILPGLAAGKVVISDRYLDSSLAYQGYGRGLPLPWLREVAREATR
GLKPRLTFLLDLPPEAALRRVRRPDRLEGLGLEFFRRVREGYLALARAEPGRFVVLDATL
PEEEIARAIQAHLRPLLP
//