[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:AAS81657.1"

            "SSU ribosomal protein S14P"
RS14Z_THETH  "RecName: Full=30S ribosomal protein S14 type Z;"

OrgPattern -------------------------------------------------------------------- 11111---------11111-11111111111111111111111111111-----------1111111111111111111111111111--------------------1-----------------1---11-----11111111--------11---11111---1-----1-----1--1-1111111111111111111111111121221211111111--11111111111111111111111111121-111-11-2111111--11---111111111111111111111111111111111-1111--1111111111111111111111111111111-11111-111111-1111111111---11------------------------------------------------------------------------------------------------------------------1111--1---------------------------------------------------------------------------1111-11111111-1111111111111111111111111111--111111-1-11111--------------------------------1------------------------------------------------------------------------------------------------------1111-----------------------------------------------------------------------------------------1-1-12111111111111-----1-111-1111111-111111111111111111-- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKAS:Sequence : ccHHHHHccccccccGGGcccccccccccccccTTTcccTTHHHHHHTTTccccccccc:Sec Str : ####################### :PROS|23->45|PS00527|RIBOSOMAL_S14|PDOC00456| : ===========================================================:RP:SCP|2->61|1fjgN|5e-20|100.0|60/60|g.39.1.7 :============================================================:BL:SWS|1->61|RS14Z_THETH|5e-33|100.0|61/61 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|19->60|PF00253|6e-09|69.0|42/55|Ribosomal_S14 61: . . . * . .: 120 :W :Sequence :c :Sec Str := :RP:SCP|2->61|1fjgN|5e-20|100.0|60/60|g.39.1.7 := :BL:SWS|1->61|RS14Z_THETH|5e-33|100.0|61/61