[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAS81657.1 tthe0 AAS81657.1 "SSU ribosomal protein S14P"
MARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKAS
W
//