[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:AAS81728.1"

            "S1 domain protein"
            ""

OrgPattern -------------------------------------------------------------------- -----------------------------------------------------------------------1---111----------------------------------------------------------------------------------------1----------------11111----1111111111111111111111111112221--333333--111222222222121212221---11----------------------------------------------------------------141---------1-11111----111111111-11-1211--11111------111-11--1-------------------------11-11-1----------------------------------------------------------------------------------------1----11------11-----1--11-1111111111111111111111--1111111111111111----1-------------1-1---------1--------------------------111-1111111111---1--1111111111111-1111-------11111111111111111-1111111111111111111111111111111--1---111111111111111-111111111111---111111-1--11111111111-1111111111111111111111111111111111-11---------11--1111111--11--111111111111------1111-------------------------------------11--11111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--1--1--1------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MWYSGGTAGGFRARRRNVELEAGTVVEGRVVRVVSFGAFVELAGGEQGLVHISQIAHEYV:Sequence : HcccTTcEEEEEEEEEETTEEEEEcccccEEEEETTTcccccc:Sec Str : XXXXXXXXXXXX :SEG|5->16|ggtaggfrarrr : XXXXXXXXXX :SEG|25->34|vvegrvvrvv : ==========================================:RP:SCP|19->92|1sroA|1e-14|45.9|74/76|b.40.4.5 : ==========================================:BL:SWS|19->93|PNP_PSEA6|1e-14|48.0|75/703 : $$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|36->84|PF00575|5e-07|46.9|49/74|S1 61: . . . * . .: 120 :TNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDLTPAPEGGAPPPRPRRLPKQSPEFENKL:Sequence :ccHHHHccTTccccccEEEEETTTEEEEcccccEcccTTTccccEEETTEEEcTTTcc :Sec Str : XXXXXXXXXXXXXXXX :SEG|95->110|papeggappprprrlp :================================ :RP:SCP|19->92|1sroA|1e-14|45.9|74/76|b.40.4.5 :================================= :BL:SWS|19->93|PNP_PSEA6|1e-14|48.0|75/703 :$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|36->84|PF00575|5e-07|46.9|49/74|S1 121: . . + . . .: 180 :KSFLRGTGGFGGKGKKGGRKKR :Sequence : :Sec Str : XXXXXXXXXXXXXXXXX :SEG|125->141|rgtggfggkgkkggrkk