[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAS81728.1 tthe0 AAS81728.1 "S1 domain protein"
MWYSGGTAGGFRARRRNVELEAGTVVEGRVVRVVSFGAFVELAGGEQGLVHISQIAHEYV
TNVRDYLNEGDIVQVLIKGRDAKGRLDLSIKDLTPAPEGGAPPPRPRRLPKQSPEFENKL
KSFLRGTGGFGGKGKKGGRKKR
//