[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:AAS81760.1"

            "iojap protein family"
            ""

OrgPattern -------------------------------------------------------------------- -1-1--------1------------------------------------11-1--1-------1--------------1-1-11111-11-1-1-----11--1-111-11111111111111111111111111111111111-111111111111111111111-1111-1-----1--1-11111111111---------------11111----11111-111111111----------------111---111111---11--11-11111---111111111111111111111--------1-------111---1111------------11------1-1--11111111111-1-111111--121---1-11-111---1------111111111111---------111-111-11111111111-111-1111111---------------1----------------1-------1--------1---------------------------------------------1-1------1-----------1------1111--1-------1-1111--111111-11--------------------1---------111---1-11111-1-111111--111--1111-------------11--1111-11-112111111111111111------111------------------1---1---111111111111---1---1------111-111---1--------111111111111111111-1111111111---------11111111111111111--------1111--11111111--------1---------------------------1111-1-111111 -------------------------------------------------------------------------------------------------------111----------1---11--11-1-141-1111---1-11--1---1-1---1------------------1--------1--------1----- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MVKTKEAVALIERIKELLAEKKAENVVALDLRRVSETLDYFVVASATSTPHLQALERHLL:Sequence : HHHHHHHHHHHTTcEEEEEEET TTcccEEEEEEEccHHHHHHHHHHHH:Sec Str : XXXXXX:SEG|55->68|lerhllekleeedl : ===================================================:RP:SCP|10->111|2id1A1|2e-20|24.5|102/120|d.218.1.12 : ==================================================:BL:SWS|11->107|CG030_MOUSE|5e-12|33.0|97/228 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|10->107|PF02410|1e-15|41.8|98/99|DUF143 61: . . . * . .: 120 :EKLEEEDLRPRPTAGQSPRWVVLDYGEVVVHLMTPEAREYYDLEGFWADAERL :Sequence :HHHHHTTccccEEEcTTTcEEEEEcccEEEEEEETTccTTTcTTTcccEEc :Sec Str :XXXXXXXX :SEG|55->68|lerhllekleeedl :=================================================== :RP:SCP|10->111|2id1A1|2e-20|24.5|102/120|d.218.1.12 :=============================================== :BL:SWS|11->107|CG030_MOUSE|5e-12|33.0|97/228 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|10->107|PF02410|1e-15|41.8|98/99|DUF143