[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAS81760.1 tthe0 AAS81760.1 "iojap protein family"
MVKTKEAVALIERIKELLAEKKAENVVALDLRRVSETLDYFVVASATSTPHLQALERHLL
EKLEEEDLRPRPTAGQSPRWVVLDYGEVVVHLMTPEAREYYDLEGFWADAERL
//