[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:AAS81794.1"

            "acyl-CoA hydrolase"
            ""

OrgPattern 11----1--------1-----1--1----111-----------------------------1------ -11-----------------------------------------------------------------1------------------------------1111--11222----------------------1---11111------------------------------------------12222---1-1111111111111111-211--111---11--------3111111111111111111111-----------------------------------------------------------------------------------------------1--1------------------------111--------111112-1-------------1-11111111--1-13211111111111--121-------1111111111----132--------------------------------11------2222222111122221111112231111--1111111112212-111----1-1111111---111----11----111-------1-------1----1-1-111111----------------111--1--11-1111111111111111111--11----1-----122--1------------------------------1-1111-1-1--------------1----------11111111111---1-----1111----21111-1-----111---1---1---1111111-1--1111--------------1221-----111--1111111---------1-11----------------------------------------------------1 -----------------------------------------------------------------------------------------------------------1-------------------------------------------------------1------------------------1---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MEARTLELVFPEHTNPLGAAFGGFVLGLMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIR:Sequence :ccEEEEEEccGGGccTTccccHHHHHHHHHHHHHHHHHTccccccEEEEEccEEcccccc:Sec Str : XXXXXXXXXXXX :SEG|17->28|lgaafggfvlgl : ======================================================:RP:SCP|7->118|1yliA1|3e-25|32.1|112/142|d.38.1.1 : =====================================================:BL:SWS|8->115|Y254_BUCBP|7e-11|33.3|108/135 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|29->88|PF03061|6e-06|54.2|59/79|4HBT 61: . . . * . .: 120 :TGDLLEVVARVVRVGRTSLTVEVEVYKERFGEGNGRVLATQGVLTYVAVNEKGEPVPVEA:Sequence :TTcEEEEEEEEEEEETTEEEEEEEEEEEHHHHHTccEEEEEEEEEEEcTTcGGGcccccH:Sec Str :========================================================== :RP:SCP|7->118|1yliA1|3e-25|32.1|112/142|d.38.1.1 :======================================================= :BL:SWS|8->115|Y254_BUCBP|7e-11|33.3|108/135 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|29->88|PF03061|6e-06|54.2|59/79|4HBT 121: . . + . . .: 180 :HAGTD :Sequence :H :Sec Str