[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:AAS81826.1"

            "NADH oxidase"
            ""

OrgPattern 2221-276555666561431322662242473322121111112112111343335336433232--- 2365B445667223C5688-AB11A9888884AABA6DKN4755445653326683522275J567CB87512223331-235442114442-4221--2242335433111111111111111222132222323222122224342432231233222222222344741222111212115434454-1456666664646676567755546661514356533235574555455555555555B87653616613322DD44674675525446445333433444453444443333333333333455333555542425666566636227441344831423-12186352425456747124116A55633232897566664555655555455555-666688787952677699F99ACC3D866677656646522222222544358442211222222112222122222212222116698258667989AAA78888BB79999938A5F4B981256476246658683256532212111111157396227744623358442144427958334533516-11-------------------113675559B63543513332473422332443551--77341-----75554646666676665-6566765676666466665877664446566676666586667855544463-4555555455551-232222234545988622211211111111197869485745288898688798A977663232231224434933333745662134434222233322335544441111111131422223-3-33211333152233---222134-544551 --11215-2-11334322123232331222222221221221222132324669222332321--11-111--211-----121--32-44322121222132636-363457443112112418A17-Ie5-744-21-51442121222-12-354547C13312733411335452Q1124799AE2I78742325 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MGKRMVVVGGVAGGASAAAKAKRENPELEVVVYEKSGWVSYGACGLPYVLSGEIPRLERL:Sequence : HHHGGcEEEEEcccccccccGGGHHHHHTTccccGGGG:Sec Str : XXXXXXXXXXXXXXXXX :SEG|6->22|vvvggvaggasaaakak : ==:RP:SCP|59->115|1uaiA|2e-04|10.5|57/223|b.29.1.18 : ======================================:BL:SWS|23->440|CDR_PYRFU|4e-82|42.4|410/442 61: . . . * . .: 120 :VARTPEEFRKQGVLVHTRHEVVDVDYELRTLTVHDHAEGRTFQDRFDHLVLATGARPSLP:Sequence :ccccHHHGGcTTcEEEETccEEEEETTTTEEEEEETTTccEEEEEccEEEEcccEEEccc:Sec Str :======================================================= :RP:SCP|59->115|1uaiA|2e-04|10.5|57/223|b.29.1.18 : ===============================:RP:SCP|90->320|1gv4A1|2e-30|16.6|217/224|c.3.1.5 :============================================================:BL:SWS|23->440|CDR_PYRFU|4e-82|42.4|410/442 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|63->283|PF07992|2e-18|41.2|211/275|Pyr_redox_2 121: . . + . . .: 180 :PIPGTEQEGVYTLRTMEDGERLLKALPQARRAAILGAGYIGLEAAEAFRKRGLQVTLLEA:Sequence :ccTTTTcTTEEEcccHHHHHHHHHHGGGccEEEEEcccHHHHHHHHHHHTTTcEEEEEEc:Sec Str :============================================================:RP:SCP|90->320|1gv4A1|2e-30|16.6|217/224|c.3.1.5 :============================================================:BL:SWS|23->440|CDR_PYRFU|4e-82|42.4|410/442 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|63->283|PF07992|2e-18|41.2|211/275|Pyr_redox_2 181: . * . . . .: 240 :KDRPLPHWDPEVGALLKEELERHGVEVWTGVKVEAFRGMGRVEAVETSEGVVPADLVLLA:Sequence :cccTTTTccHHHHHHHHHHHHHTTEEEEEcccEEEEEEETTEEEEEETTccEEEcEEEEc:Sec Str :============================================================:RP:SCP|90->320|1gv4A1|2e-30|16.6|217/224|c.3.1.5 :============================================================:BL:SWS|23->440|CDR_PYRFU|4e-82|42.4|410/442 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|63->283|PF07992|2e-18|41.2|211/275|Pyr_redox_2 241: + . . . . *: 300 :TGIRPNTELAQAMGVALGPTGAIATDERMRTNLEGVYAAGDVAESFHRVLKRPYWLPLGD:Sequence :ccEEEccGGGTTcTccccTTccccccTTcccccTTEEEcGGGccEEEGGGTEEEccccHH:Sec Str :============================================================:RP:SCP|90->320|1gv4A1|2e-30|16.6|217/224|c.3.1.5 :============================================================:BL:SWS|23->440|CDR_PYRFU|4e-82|42.4|410/442 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|63->283|PF07992|2e-18|41.2|211/275|Pyr_redox_2 301: . . . . + .: 360 :VANKHGRTAGSVIAGREARFLGVVGTAIFKAFDLAVATTGLSLEGALKEGFWAKKVFIQS:Sequence :HHHHHHHHHHHTccccccccccccccEEEEETTEEEEEEEccHHHHHHTTcccEEEEEEE:Sec Str :==================== :RP:SCP|90->320|1gv4A1|2e-30|16.6|217/224|c.3.1.5 : =======================================:RP:SCP|322->442|1f8wA3|2e-19|24.0|121/126|d.87.1.1 :============================================================:BL:SWS|23->440|CDR_PYRFU|4e-82|42.4|410/442 361: . . . * . .: 420 :RDGAHYYPGSGPLWVELVYEEGTGRLLGGAVVARGHGALRIDVLAALLHREGSVEDLLAL:Sequence :EcccTTcccccEEEEEEEEcTTTccEEEEEEEEccccTHHHHHHHHHHHTTccHHHHHHc:Sec Str : XXXXX:SEG|416->423|dllaldla :============================================================:RP:SCP|322->442|1f8wA3|2e-19|24.0|121/126|d.87.1.1 :============================================================:BL:SWS|23->440|CDR_PYRFU|4e-82|42.4|410/442 421: . . + . . .: 480 :DLAYAPPFSPVWDPLLIAAQQAR :Sequence :cccccTTTcccccHHHHHHHHHc :Sec Str :XXX :SEG|416->423|dllaldla :====================== :RP:SCP|322->442|1f8wA3|2e-19|24.0|121/126|d.87.1.1 :==================== :BL:SWS|23->440|CDR_PYRFU|4e-82|42.4|410/442