[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:AAS81982.1"

            "folylpolyglutamate synthase"
            ""

OrgPattern ------------------------21111111-----------------------------111---- 1111111----11111111-11111-1111111111111111111-11111111111111111111111111111111111111111111111111---11111111111--------------111111111111111111111211112211111111111111211111111111111112212211121111111111111111111111111111121111111111111111111111111111111111211221212222112113211111112111222222222222222222222222222222222222111211111111111111111111111111111111111111111111212111122211111111111111122211111111111-211111111111211111111111111121111111111111111111111111111111111111111111111111111-11121111111111111111111111111111-1111111111111121111111111111111111111111111111-1111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111-1111111-11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--111111111111111111111111111111111111111111111111111111111111111111111111111----11--------111--1-1---1--------1-------1211111111121 11--111-311-22233222333343233533343333233322215423234323222321222222222222222-2222222222-13232232122222223-1-12111-1211-11112-13-8D2-311-1-111-3--11111--11111223212111121133111-12A3122231162651111111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDPLSWLYARQGRFAPGLERIRALLARLGHPEEAYPVALVGGTNGKGTTARTLAAILEEA:Sequence :HHHHHHHTTcGGGccccHHHHHHHHHHHcHHHHHHHHHHHHHHTTccEEEcTTccEETTc:Sec Str :============================================================:RP:SCP|1->279|1o5zA2|7e-49|37.8|267/284|c.72.2.2 : ===========================================================:BL:SWS|2->405|FOLC_BACSU|7e-49|35.5|397/430 : $$$$$$$$$$$$$$$$$$$$$:RP:PFM|40->253|PF08245|4e-14|50.6|172/187|Mur_ligase_M 61: . . . * . .: 120 :GFRVGLYTSPHLVDFRERIQVQGRPIPEEKLLALLAELRPHAERLEASFFEAATALALLH:Sequence :ccccccccccHHTTcccTTHHHHccccHHHHHHHHHHHHHHHHHHTTccccHHHHHHHHH:Sec Str : XXXXXXXXXXXXXXXXXXXXX :SEG|87->107|peekllallaelrphaerlea :============================================================:RP:SCP|1->279|1o5zA2|7e-49|37.8|267/284|c.72.2.2 :============================================================:BL:SWS|2->405|FOLC_BACSU|7e-49|35.5|397/430 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|40->253|PF08245|4e-14|50.6|172/187|Mur_ligase_M 121: . . + . . .: 180 :FAREGVEFAVLEVGLGGRLDATNATEPVLSVVTNVGHDHLEVLGPTLKDVAREKAGIFRG:Sequence :HHHHTTccEEEEccHHHHHTTTTTccccEEEEcccccccHHHHccHHHHHHHHHHHcccc:Sec Str :============================================================:RP:SCP|1->279|1o5zA2|7e-49|37.8|267/284|c.72.2.2 :============================================================:BL:SWS|2->405|FOLC_BACSU|7e-49|35.5|397/430 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|40->253|PF08245|4e-14|50.6|172/187|Mur_ligase_M 181: . * . . . .: 240 :GVPALTAAQGEGLGVLRAEALARKTPLWVLGEDFHAEGVEALPEGLAFTLRLERTGEALR:Sequence :cEEEEETTcHHHHHHHTTcTTcEEEEcccccEEEEEEEEEEccccEEEEETEEEETTccE:Sec Str :============================================================:RP:SCP|1->279|1o5zA2|7e-49|37.8|267/284|c.72.2.2 :============================================================:BL:SWS|2->405|FOLC_BACSU|7e-49|35.5|397/430 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|40->253|PF08245|4e-14|50.6|172/187|Mur_ligase_M 241: + . . . . *: 300 :LTARLLGPHQAENLALAALSGRLLGAGWEAVKRGVARAENPGRLQRLLWRGRELLLDGAH:Sequence :EEEEcccHHHHHHHHHHHHHHHHTTccHHHHHHHGGGcccTTcEEEccTTccEEEEEccc:Sec Str : XXXXXXXXXXXXXX :SEG|254->267|lalaalsgrllgag :======================================= :RP:SCP|1->279|1o5zA2|7e-49|37.8|267/284|c.72.2.2 : ===================:RP:SCP|282->414|1o5zA1|1e-13|35.3|133/137|c.59.1.2 :============================================================:BL:SWS|2->405|FOLC_BACSU|7e-49|35.5|397/430 :$$$$$$$$$$$$$ :RP:PFM|40->253|PF08245|4e-14|50.6|172/187|Mur_ligase_M 301: . . . . + .: 360 :NPEGALALREALRFHGLLPAAFVLGFSRDKDHAAMAEALRGLGPVVLTRYASLRSEDPRA:Sequence :cHHHHHHHHHHHHccccEEEEEccccccccTHHHHHHHHHHHccEEEEccccccTccHHH:Sec Str :============================================================:RP:SCP|282->414|1o5zA1|1e-13|35.3|133/137|c.59.1.2 :============================================================:BL:SWS|2->405|FOLC_BACSU|7e-49|35.5|397/430 361: . . . * . .: 420 :LLPLFPGAKVVEDPLEALEEAFSREGRVVVAGSLYLVGEVLRRLEGLPAEERWQ :Sequence :HHTccTTccEEccHHHHHHHHHHcTTEEEEEccTTccEEEETTEHHccccGGGG :Sec Str :====================================================== :RP:SCP|282->414|1o5zA1|1e-13|35.3|133/137|c.59.1.2 :============================================= :BL:SWS|2->405|FOLC_BACSU|7e-49|35.5|397/430