[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:AAS81992.1"

            "sulfite dehydrogenase"
            ""

OrgPattern 111-112122222223-2111111-11--111-----------11----11---------1111---- -1114----------------1--12-----11111-121-2-2-3---2--132--1--211-1-23211-----------111111-----------------1-1----------------------------1111111-112113111-------------22221------------21112---1-1-----------------11-1---111----------22----------------------------------------------------------------------------------------------------------------------------------------------1-----------111---22122------------11211211----1---1111111112---------------------111--11-------------------------------1--1-----1---11---------1111-1--11------111-----1-2-1--1---11-1------------2------------------------223211--------------------------------------------------------------------------1-1--------------------------------------------------------1------------------------------------------------------------------1121--1---------------------------------------------------------------------------------------------------------1- -------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------1--1----------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTWPAFSLGVWGYPEGMDPRVPPGQFVTERFPILTYGETPKVAKEAWRLEVTGLVETPLV:Sequence : EccHHHHHHHTccccGGccEEEccccccccGGGcEEEEEEcccccEE:Sec Str : ===========================================:RP:SCP|18->200|1xdqA|2e-34|23.1|182/262|d.176.1.1 : ================:BL:SWS|45->192|Y1836_ACTSZ|5e-12|32.0|147/317 : $$$$$$$$$$$$$$$$$$$:RP:PFM|42->184|PF00174|2e-20|40.6|143/156|Oxidored_molyb 61: . . . * . .: 120 :LTYEDLLARPQVELTRDFHCVTRWSRLDVTWKGVRTRDLLEEARPRPEAVAALVESYGGY:Sequence :EEHHHHHHHccEEEEEEEEcTTTTHHHHEEEEEEEHHHHHHHHcccTTccEEEEEETccc:Sec Str : XXXXXXXXXXXXXXX :SEG|100->114|leearprpeavaalv :============================================================:RP:SCP|18->200|1xdqA|2e-34|23.1|182/262|d.176.1.1 :============================================================:BL:SWS|45->192|Y1836_ACTSZ|5e-12|32.0|147/317 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|42->184|PF00174|2e-20|40.6|143/156|Oxidored_molyb 121: . . + . . .: 180 :TTNLLLEDLLREDVLLAHTLFGKPLPPERGGPVRLLVPHLYAWKSAKWVRRIVLLDHLEL:Sequence :EEEEEHHHHTcTTTccEEEETTEEccGGGTTTcEEEcTTccGGGccccEEEEEEEccccc:Sec Str : XXXXXXXXXXXXX :SEG|124->136|llledllredvll :============================================================:RP:SCP|18->200|1xdqA|2e-34|23.1|182/262|d.176.1.1 :============================================================:BL:SWS|45->192|Y1836_ACTSZ|5e-12|32.0|147/317 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|42->184|PF00174|2e-20|40.6|143/156|Oxidored_molyb 181: . * . . . .: 240 :GFWERLGYHWRGDPWKEERFQEGPVPAHRIRFAARNKPGR :Sequence :cHHHHcccccccTTccHHHHHHcGGGGccGGGc :Sec Str :==================== :RP:SCP|18->200|1xdqA|2e-34|23.1|182/262|d.176.1.1 :============ :BL:SWS|45->192|Y1836_ACTSZ|5e-12|32.0|147/317 :$$$$ :RP:PFM|42->184|PF00174|2e-20|40.6|143/156|Oxidored_molyb