[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:AAS82156.1"

            "bacitracin resistance protein (putative undecaprenol kinase)"
UPPP_THET2  "RecName: Full=Undecaprenyl-diphosphatase;         EC=3.6.1.27;AltName: Full=Undecaprenyl pyrophosphate phosphatase;AltName: Full=Bacitracin resistance protein;"

OrgPattern -------------------------------------1------------------------------ -1---------------------------------------222---1------1--1----11---1111-------1----11111------11---1111--111-1--------------------1------11-1------------------------------------------11111-----1222232121323332--11--233-111---------111--1111-11---11-11-----11111---11--111----1111---1---1--111111111111111111------11111111111-111-------1-1-222----11111-111-111-----1-111--11-1-1111-------1111111111111111111111-11111111111112211111111111-----11111----------------111-------------------------------11111----222222111112211111111221211111---111112111-111111111111111111111111---1-11-111111111-1-1----1-----1--11111111----------11-1--1111-11-111-1111--11111-211111--1---1--------111-1---------------------------------1111-----------------1------11-111111111111-------------1-111---------------1111112111111111111-1----11-1---------1--------------11111111111111--------11----------------------------------------------1-1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MGRVSAWEALLLGVVEGLTEFLPVSSTGHLTLLFHLLGLPVEEDPFLKTFLVAIQLGAIL:Sequence : XXXXXXXXXXXXXXX :SEG|25->39|sstghltllfhllgl :============================================================:BL:SWS|1->261|UPPP_THET2|e-101|100.0|261/261 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->251|PF02673|5e-18|34.9|238/254|BacA 61: . . . * . .: 120 :AVLLLYGRRLAADRALWLRIAVAFVPTGVIGFFFYPLIKGVILGNDAVVAFFLFFVGAVL:Sequence : XXXXXXXXXXXXXX :SEG|68->81|rrlaadralwlria : XXXXXXXXXXXXXX:SEG|107->123|avvafflffvgavllfa :============================================================:BL:SWS|1->261|UPPP_THET2|e-101|100.0|261/261 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->251|PF02673|5e-18|34.9|238/254|BacA 121: . . + . . .: 180 :LFADRLAERAQYQDVKALPLARVAWIGVFQGLAALFPGTSRSGATILGGLLLGLNRQAAA:Sequence :XXX :SEG|107->123|avvafflffvgavllfa : XXXXXXXX :SEG|167->174|lgglllgl :============================================================:BL:SWS|1->261|UPPP_THET2|e-101|100.0|261/261 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->251|PF02673|5e-18|34.9|238/254|BacA 181: . * . . . .: 240 :EFSFLLALPTMFAAVGYDLWKSAPEVPEGGWSLLLLGFLAALATALVTVRWMLAFVARHG:Sequence : XXXXXXXXXXXXXX :SEG|213->226|llllgflaalatal :============================================================:BL:SWS|1->261|UPPP_THET2|e-101|100.0|261/261 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->251|PF02673|5e-18|34.9|238/254|BacA 241: + . . . . *: 300 :FRPFALYRMALAAVYAFFFLR :Sequence :===================== :BL:SWS|1->261|UPPP_THET2|e-101|100.0|261/261 :$$$$$$$$$$$ :RP:PFM|8->251|PF02673|5e-18|34.9|238/254|BacA